Marquise Cut Real Diamond Cluster Flower Stud Earrings

0
Regular price $1,499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Get ready to dazzle with these classy nature-inspired Diamond Stud Earrings that showcase your sophisticated and graceful style. Embracing all the beautiful aspects of life, these Flower Earrings can elevate even the simplest outfit for any occasion. The cluster of Marquise Cut Diamonds set in Prong Setting is arranged to beautifully mimic a flower design. The eye-catching cluster of HI-SI Quality Diamonds creates a sparkling effect, while the simple yet stylish design ensures they remain timeless. Renowned for their natural shine, timeless elegance, and versatility, these Flower Stud Earrings perfectly blend luxury with understated beauty. The floral design of the studs brings an elegant yet playful vibe, with a floral motif that radiates refined femininity, enhancing your overall style. Add a touch of sparkle to your jewelry collection with these stunning Real Diamond Earrings, which can effortlessly complement any outfit and make a thoughtful gift for birthdays or anniversaries. Perfect for anyone who appreciates elegant yet versatile accessories, these Diamond Cluster Earrings are as beautiful as they are easy to wear.

Product Information
SKU SHP-EARRINGS022210552
Metal Weight 1.20 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-12 Pcs
Marquise-2X4 mm-2 Pcs
Color HI
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings