Marquise and Round Shape Natural Diamond Wrap Ring

0
Regular price $1,059
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace the elegance of nature with the Diamond Leaf Wrap Ring which features a delicate, intricately designed leaf motif that wraps gracefully around your finger. This Diamond Promise Ring showcases a stunning array of brilliant-cut Marquise and Round Diamonds, meticulously set to catch and reflect light with every movement. The leaf design, inspired by the timeless beauty of nature, is enchanting and sophisticated. Each diamond has its sparkle, ensuring a dazzling statement of refined taste and style. Perfect for celebrating a special occasion or simply adding a touch of luxury to your everyday look, this Promise Ring for Her combines artistry with craftsmanship. Its versatile design makes it an ideal choice for both elegant evening wear and casual chic outfits. Make a statement of enduring beauty with this enchanting Diamond Ring Enhancer that embodies the grace and splendor of nature’s finest creations.

Product Information
SKU SHP-RINGS0821330660
Width 2.2 mm
Height 6.8 mm
Metal Weight 1.80 gm (Approximate)
Total Stone Weight 0.30 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-4 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings