London Blue Topaz and Diamond Flower Drop Earrings

0
Regular price $839
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Deep blue London Blue Topaz meets the soft romance of a floral drop silhouette in these earrings designed for graceful movement and expressive color. Each earring brings together a flower-inspired top with a pear-cut London Blue Topaz drop, creating a look that feels poised, feminine, and meaningful without becoming overly ornate. The rich blue gemstones and white lab grown diamond accents make this pair a thoughtful gift for birthdays, anniversaries, personal milestones, or a polished self-purchase with a little more emotion behind it.

London Blue Topaz and Diamond Flower Drop Earrings with Pear and Marquise Gemstones

These flower drop earrings feature 6 London Blue Topaz stones with an approximate total weight of 1.76 carat, arranged in marquise and pear shapes for a petal-and-drop effect. Four marquise-shaped lab grown diamonds add approximately 0.24 carat of white sparkle, bringing contrast to the blue gemstone design. Finished with prong settings and screw-back closures, the pair combines detailed floral styling, secure wear, and a refined dangle profile.

What Makes This Special

The London Blue Topaz layout includes 4 marquise stones measuring approximately 3X6 mm and 2 pear-shaped stones measuring approximately 3X5 mm. Together, they create a floral motif with a suspended drop that adds gentle movement below the ear.

The accent stones include 4 marquise-shaped lab grown diamonds measuring approximately 2X4 mm each. These white diamonds are brilliant cut, EF-VS quality grade, and prong set to complement the blue gemstone arrangement.

The earrings measure approximately 11.6 mm in length, 7.8 mm in width, and 2.2 mm in height, with an approximate metal weight of 1.50 gm and an approximate total stone weight of 2.00 carat. They are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Why Choose This Design

The floral arrangement gives these earrings a soft, expressive shape, while the pear-cut drop adds a sense of movement that catches light as you turn. Marquise-cut gemstones create elongated petal-like lines, helping the design feel delicate without losing visual presence.

London Blue Topaz brings a deep blue tone that pairs beautifully with the white sparkle of lab grown diamonds. Prong settings keep the stones visually open, allowing the shape and color of each gemstone to stand out. The screw-back closure adds a secure, comfortable finish for longer wear.

Design Meaning

The flower design speaks to growth, confidence, renewal, and personal beauty. London Blue Topaz brings a calm, oceanic blue tone often chosen for its composed and expressive feel, while the drop silhouette adds graceful movement. Together, the design makes a meaningful jewelry gift for someone who appreciates color, softness, and a quietly distinctive style.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to gemstone alignment, secure prong setting, refined finishing, and comfortable screw-back construction. Rosec Jewels offers a Certificate of Authenticity with the product, adding assurance to the purchase. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection. To care for these earrings, store them separately, avoid harsh chemicals, and clean gently with a soft cloth after wear.

Style and Wearability

These London Blue Topaz flower drop earrings bring color and movement to everyday outfits, evening looks, and special-occasion styling. The compact drop length makes them easy to wear with open necklines, soft knits, tailored blouses, or occasion dresses. Choose white metal for a cooler, crisp contrast or yellow gold for a warmer finish against the deep blue gemstones. Their screw-back closure makes them a practical choice for secure wear while still offering the charm of a dangle earring.

Product Information
SKU SHP-EARRINGS022210357
Length 11.6 mm
Width 7.8 mm
Height 2.2 mm
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 2.00 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 6 Pieces
Total Weight 1.76 Carat (Approximate)
Dimension(approx) Marquise-3X6 mm-4 Pcs
Pear-3X5 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Marquise, Pear
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-4 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
dangle-earrings

FAQs About: London Blue Topaz and Diamond Flower Drop Earrings

What gemstones are used in these flower drop earrings?

These earrings feature London Blue Topaz and lab grown diamonds. The London Blue Topaz stones have an approximate total weight of 1.76 carat, while the lab grown diamonds add approximately 0.24 carat.

What shapes are used in the London Blue Topaz design?

The London Blue Topaz stones include 4 marquise stones measuring approximately 3X6 mm and 2 pear-shaped stones measuring approximately 3X5 mm. The marquise stones form the floral detail, while the pear-shaped stones create the drop effect.

Do these earrings include diamond accents?

Yes. The earrings include 4 marquise-shaped lab grown diamonds measuring approximately 2X4 mm each. They are white in color, brilliant cut, EF-VS quality grade, and secured in prong settings.

What does the floral drop design symbolize?

The floral design can symbolize growth, confidence, renewal, and personal beauty. The drop element adds graceful movement, making the earrings meaningful for birthdays, anniversaries, celebrations, or personal milestones.

What metal options are available for these earrings?

These earrings are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Are these earrings secure for wear?

Yes. The earrings are finished with screw-back closures, which help provide a secure and comfortable fit for daily styling, occasion wear, and gifting.

How should I care for London Blue Topaz and diamond drop earrings?

Store the earrings separately, avoid harsh chemicals, and wipe them gently with a soft cloth after wear. For occasional cleaning, use mild soap with lukewarm water, dry carefully, and check the screw backs before wearing.