Lab Created Emerald and Diamond Spiral Stud Earrings

0
Regular price $1,689
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Lab Created Emerald and Diamond Spiral Stud Earrings are designed for the woman who loves color, movement, and refined sparkle in one expressive pair. At the center of each stud sits a 6 mm round lab created emerald, held in a prong setting to showcase its vivid green color. Around each emerald, petite round diamonds curve in a graceful spiral, creating a soft sense of motion and light from every angle.

These emerald and diamond stud earrings feel meaningful without being overly formal, making them a thoughtful choice for anniversaries, birthdays, Valentine’s Day, milestone gifting, or a personal jewelry upgrade. The spiral design gives the pair a distinctive identity, while the screw back closures support secure, comfortable wear for day-to-evening styling.

1.5 Carat Lab Created Emerald and Diamond Spiral Stud Earrings

These spiral stud earrings feature two round brilliant cut lab created emeralds totaling approximately 1.60 carats, accented by 90 round brilliant cut diamonds totaling approximately 0.46 carat. The emeralds and diamonds are arranged in prong settings, with the diamonds twisting around the green center stones in a spiral pattern. Available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, the earrings can be selected in the metal tone that best suits the wearer’s style.

What Makes This Special

  • Pair of spiral stud earrings featuring round lab created emerald center stones.
  • Includes 2 round lab created emeralds measuring approximately 6X6 mm each.
  • Total lab created emerald weight is approximately 1.60 carats.
  • Emeralds are listed as green, brilliant cut, round shape, and AAAA quality grade.
  • Designed with 90 round diamond accents for added sparkle around the spiral motif.
  • Total diamond weight is approximately 0.46 carat.
  • Diamonds are listed as HI color, SI quality grade, round shape, and brilliant cut.
  • Prong setting is used for both the emeralds and diamond accents.
  • Screw back closures support secure and comfortable wear.
  • Earring dimensions are approximately 10.8 mm in length and 11 mm in width.
  • Approximate earring weight is 2.90 gm.
  • Presented as certified jewelry, made with precious metal options, and checked by hand.

Why Choose This Design

The round lab created emeralds create a bright green focal point, while their brilliant cut helps bring light into the center of each earring. Green emerald gives the studs a rich gemstone identity, making them ideal for someone who wants color and meaning rather than a diamond-only look.

The spiral design adds movement around the center stones, allowing the diamond accents to frame the emeralds in a more artistic way than a standard halo. This makes the earrings feel polished yet expressive. The prong setting keeps the stones visible, while the screw back closures add practical security for everyday wear, occasion styling, and thoughtful gifting.

Design Meaning

The spiral shape suggests growth, renewal, and a journey that continues forward. Paired with green lab created emeralds, the design carries a sense of hope, harmony, and emotional depth. It is a meaningful choice for celebrating love, a new chapter, a personal achievement, or a relationship that continues to grow stronger.

The diamonds around the emeralds add a symbolic layer of light and celebration. Together, the green center stones and sparkling spiral accents create earrings that feel both sentimental and stylish, making them suitable for anniversaries, birthdays, Valentine’s Day, or a self-gift chosen with intention.

Authenticity & Craftsmanship

These certified earrings are carefully inspected by hand and offers to order in your choice of precious metal. Each pair features 2 lab-created AAAA-grade emeralds and 90 diamonds with HI color and SI clarity.

The prong-set emeralds and diamonds are arranged in an elegant spiral design, creating a refined look for everyday wear or special occasions. The secure screw-back closures help keep the earrings comfortable and firmly in place.

Style and Wearability

From the front, each earring shows a green emerald center surrounded by a twisting trail of diamond sparkle. The 10.8 mm by 11 mm size gives the studs visible presence on the ear without becoming oversized, making them versatile for both formal and everyday styling.

White metal options create a crisp contrast with the green emeralds and white diamonds, while yellow gold options add warmth to the gemstone color. Wear them with evening dresses, workwear, festive outfits, or simple everyday looks when you want a refined pop of green and diamond light. They also make a gift-ready choice for someone who loves gemstone earrings with graceful movement and secure wear.

Product Information
SKU SHP-EARRINGS052174982
Length 10.8 mm
Width 11 mm
Weight 2.90 gm (Approximate)
Center Stone Weight 1.60 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 1.60 Carat (Approximate)
Dimension(approx) Round-6X6 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 90 Pieces
Total Weight 0.46 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-30 Pcs
Round-1X1 mm-48 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-earrings

FAQs About: Lab Created Emerald and Diamond Spiral Stud Earrings

What makes these emerald and diamond earrings a meaningful gift?

These earrings combine green lab created emeralds with diamond spiral accents, giving them both color and celebratory sparkle. The spiral design can symbolize growth and a continuing journey, making the pair a thoughtful gift for anniversaries, birthdays, Valentine’s Day, or personal milestones.

What gemstones are used in these stud earrings?

The earrings feature 2 round lab created emeralds measuring approximately 6X6 mm each. The total lab created emerald weight is approximately 1.60 carats, and the emeralds are listed as green, brilliant cut, and AAAA quality grade.

Do these earrings include diamond accents?

Yes. The earrings include 90 round brilliant cut diamonds with an approximate total weight of 0.46 carat. The diamonds are listed as HI color and SI quality grade and are arranged in a spiral design around the emerald centers.

What setting style is used for the emeralds and diamonds?

The lab created emeralds and diamond accents are set in prong settings. This setting style helps keep the round emeralds and petite diamonds visible while supporting a secure, polished presentation.

What closure type do these spiral stud earrings have?

These earrings come with screw back closures. This closure style is designed to provide a secure and comfortable fit for day-to-evening wear.

What metal options are available for these earrings?

These earrings are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These options allow buyers to choose a bright white metal finish or a warmer yellow gold tone.

How should I care for these lab created emerald and diamond earrings?

Clean the earrings gently with mild soap, warm water, and a soft brush, then dry them with a lint-free cloth. Avoid harsh chemicals and store them separately in a jewelry box to help protect the prong settings, emeralds, diamonds, screw backs, and metal finish.