Graduated Diamond Star Crawler Earring for Helix Piercing

0
Sale price $713 Regular price $819
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Our Graduated Diamond Star Crawler Earring is bursting with celestial beauty and charm!

  • Adorned with exquisite graduated size diamonds secured by prong setting on a star motif. This Piercing Earring will be the shining star of your chic ear stack.
  • You can wear this Diamond Climber Earring on your Helix, Cartilage, or Upper Lobe Piercing. This stunner boasts a flat back, no more pokes or jabs during quick naps or beauty sleep extravaganzas.
  • Elevate your look with a celestial beauty that twinkles with every move and pair it with your other diamond piercing jewelry!
Product Information
SKU SHP-BODYJ0921397156
Length 26.2 mm
Width 6.1 mm
Height 2 mm
Metal Weight 1.90 gm (Approximate)
Total Stone Weight 0.89 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 42 Pieces
Total Weight 0.89 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-20 Pcs
Round-1.20X1.20 mm-15 Pcs
Round-2X2 mm-4 Pcs
Round-3X3 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More