Genuine Diamond Infinity Stud Earrings

0
Regular price $1,089
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enjoy timeless elegance and meaningful design with these exquisite Diamond Infinity Earrings. Beautifully crafted to symbolize everlasting love, strength, and infinite possibilities, these Open Circle Earrings feature a graceful infinity motif nestled within a sparkling open-circle frame. The harmonious combination of these iconic shapes creates a sophisticated and contemporary design that carries both style and sentiment. At the heart of each earring lies a polished infinity symbol, representing an unbreakable bond and endless connection. A row of genuine diamonds delicately accents one side of the infinity design. Surrounding it, an open circular halo adorned with shimmering diamonds creates a radiant frame that enhances the overall sparkle and visual appeal. Together, these elements form an eye-catching design that feels elegant, meaningful, and effortlessly wearable. Designed with comfort and security in mind, the Infinity Stud Earrings feature screw-back closures that provide a dependable fit throughout the day. This thoughtful detail makes them ideal for regular wear, offering peace of mind without compromising on style. Perfect as a gift for a loved one, an anniversary keepsake, a birthday surprise, or a meaningful self-purchase, these Real Diamond Stud Earrings carry a message that goes beyond beauty.

Product Information
SKU SHP-EARRINGS022150247
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.35 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 88 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-88 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
infinity-jewelry