Genuine Diamond Blooming Flower Engagement Ring for Women

0
Regular price $2,759
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Blooming Flower Diamond Engagement Ring

This engagement ring is designed for those drawn to romantic symbolism and timeless elegance. The blooming flower motif reflects growth, commitment, and enduring connection, making it a meaningful choice for proposals and milestone moments.

Its balanced design offers visual presence without excess, appealing to buyers who appreciate refined detailing and classic beauty.

Floral-Inspired Design & Setting

The flower-inspired setting is crafted to create depth and dimension, allowing each diamond to contribute to a unified, blooming appearance. The structure supports the stones securely while enhancing their natural brilliance.

This design blends softness with structure, resulting in a ring that feels romantic yet composed when worn.

Diamond Value & Wear Considerations

Diamonds are valued for their durability and suitability for everyday wear. When properly set and cared for, they maintain their appearance over time.

The arrangement of diamonds in this ring is intended to provide visual harmony while supporting long-term wear.

High-Level Features

  • Genuine diamond centerpiece and accents
  • Blooming flower-inspired engagement design
  • Balanced, elegant silhouette
  • Designed for lasting comfort and presence
Product Information
SKU SHP-RINGS032210163
Metal Weight 4.70 gm (Approximate)
Total Stone Weight 0.83 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 125 Pieces
Total Weight 0.83 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1X1 mm-32 Pcs
Round-0.90X0.90 mm-88 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-engagement-rings
Is this ring suitable for everyday wear?
Diamonds are generally suitable for everyday wear when the ring is worn with standard care.
Does the floral design sit high on the finger?
The floral setting is designed to provide dimension while maintaining balance and comfort on the hand.
Are the diamonds securely set?
The setting is crafted to hold the diamonds securely for regular wear.
Can this ring be worn as an engagement ring?
Yes, this design is created specifically to serve as an engagement ring.
How should the ring be cleaned?
Gentle cleaning with mild soap and water is recommended, avoiding harsh chemicals.