Genuine 3 Carat Garnet Teardrop Earrings with Diamond Leaf

0
Regular price $198
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate the beauty of nature with these stunning Nature-Inspired Garnet Drop Earrings. Designed to capture the essence of natural elegance, these Teardrop Earrings feature a graceful leaf motif adorned with sparkling round cut EF-VS quality lab grown diamonds. Dangling below is a beautifully faceted 6X8 MM pear shaped real Garnet set in prong setting and known as the January birthstone. The garnets used are of AAA quality, ensuring exceptional color, clarity, and brilliance. Suspended delicately, the garnet drop adds a rich and sophisticated contrast to the dazzling diamond encrusted leaves above. Crafted in Yellow Gold Plated Silver, the metal beautifully complements the richness of the garnet and the sparkle of the diamonds. The Garnet and Diamond Earrings are thoughtfully designed with a secure screw back closure, offering comfort and peace of mind whether you are wearing them casually or for a special occasion. Perfect for those who admire nature’s delicate beauty, or for anyone born in January, these Leaf Earrings make a thoughtful gift or a meaningful self-purchase.

Product Information
SKU RCEA062510008-FBA
Weight 2.40 gm (Approximate)
Center Stone Weight 3.00 Carat (Approximate)
GARNET INFORMATION
No.of Stones 2 Pieces
Total Weight 3.00 Carat (Approximate)
Dimension(approx) Pear-6X8 mm-2 Pcs
Color Red
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-14 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.20X1.20 mm-6 Pcs
Round-1.30X1.30 mm-6 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More