Flower Inspired London Blue Topaz and Diamond Engagement Ring

0
Regular price $649
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This exquisite Blue Topaz Flower Ring represents a distinctive fusion of craftsmanship and brilliance, intended to elevate every occasion. At its core lies a stunning 5 MM round cut London Blue Topaz, securely fastened by a prong setting. Encircling the central stone is a floral halo, artfully designed with small round Diamond stones arranged to resemble delicate petals. This design imparts the Flower Engagement Ring with a sophisticated yet striking character that exudes elegance and freshness. The split shank contributes to an open, airy aesthetic that complements the intricate floral setting. The overall appearance combines modern structure with floral delicacy, making it perfect for those who value exquisite design with a personal touch. Whether selected as an engagement ring or worn as a bold cocktail piece, this London Blue Topaz Engagement Ring effortlessly captures attention. The flower motif introduces a romantic essence, while the split band and meticulous stone arrangement provide a unique, contemporary flair. The AAA quality london blue topaz and HI-SI Diamond stone delivers exceptional brilliance and is recognized for its durability, rendering this Cocktail Ring ideal for both daily wear and special events. It serves as a wonderful means to convey individuality and style through a piece that is both meaningful and beautifully crafted.

Product Information
SKU SHP-RINGS042210121
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 0.60 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 48 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-24 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1X1 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-engagement-rings