Elegant Certified Moissanite Butterfly Ear Pin Earring

0
Regular price $1,519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Graceful Butterfly Ear Pin Earrings with Moissanite

These Elegant Certified Moissanite Butterfly Ear Pin Earrings bring a delicate and expressive design to everyday jewelry. Inspired by the graceful form of a butterfly, the silhouette creates a soft and artistic look along the ear, making them an appealing choice for those who enjoy jewelry that feels both refined and distinctive.

The ear pin style allows the design to follow the natural curve of the ear, creating a balanced and modern appearance. Combined with the sparkle of moissanite, the earrings offer a subtle yet eye-catching accent suitable for both daily wear and special occasions.

A Thoughtful Design Inspired by Nature

The butterfly motif has long symbolized transformation, beauty, and lightness. In these earrings, the motif is interpreted through a clean and elegant arrangement that highlights the shape without overwhelming the ear. The ear pin structure creates a streamlined look that sits comfortably while adding visual dimension to the design.

By extending gently along the ear, the ear pin style offers a contemporary alternative to traditional stud earrings. This approach creates movement and interest while maintaining a refined and wearable silhouette.

The Brilliance of Certified Moissanite

Moissanite is admired for its exceptional sparkle and clarity, making it a popular choice for fine jewelry. Each stone reflects light with impressive brilliance, helping the butterfly design appear luminous and elegant when worn.

Moissanite is created without traditional mining, offering an alternative gemstone option for modern jewelry. As with all manufactured gemstones, environmental impact can vary depending on production methods and energy sources.

Elegant Earrings for Everyday Styling

The combination of the butterfly motif and shimmering moissanite makes these earrings suitable for a variety of occasions. Their graceful design works well with both casual outfits and more formal attire, offering versatility within a refined jewelry collection.

Whether chosen as a thoughtful gift or as a personal addition to a jewelry wardrobe, these ear pin earrings provide a unique interpretation of nature-inspired design paired with brilliant gemstone sparkle.

Product Information
SKU SHP-BODYJ0921397791
Length 11 mm
Width 29 mm
Height 3.3 mm
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.43 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 6 Pieces
Total Weight 0.43 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-6 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Elegant Certified Moissanite Butterfly Ear Pin Earring

What is an ear pin earring?
An ear pin earring is designed to follow the curve of the ear rather than sitting directly on the earlobe. This style creates a modern and elongated appearance that adds dimension to the overall look.
What makes moissanite a popular gemstone for earrings?
Moissanite is valued for its exceptional brilliance and clarity. Its ability to reflect light creates noticeable sparkle, making it a favored gemstone for many types of fine jewelry including earrings.
Are butterfly-inspired earrings suitable for everyday wear?
Butterfly-inspired earrings are often chosen for their elegant and symbolic design. Their balanced structure makes them suitable for regular wear while still offering a distinctive decorative look.
Do ear pin earrings require special piercings?
Most ear pin earrings are designed to be worn with standard ear piercings. The structure typically slides through the piercing and rests along the ear to create the intended look.
Are moissanite gemstones created naturally?
Moissanite used in jewelry is typically created in controlled environments rather than mined. These gemstones are produced to achieve consistent quality and brilliance.
Are these earrings suitable as a gift?
Their elegant butterfly design and sparkling gemstones make these earrings a thoughtful gift choice for birthdays, anniversaries, celebrations, or special occasions.