Diamond Pisces Zodiac Earring for Cartilage Piercing

0
Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Subtle Symbol for Pisces

The Diamond Pisces Zodiac Earring for Cartilage Piercing is designed for those who prefer jewelry with personal meaning. Inspired by the Pisces constellation, this piece translates astrological symbolism into a refined, minimal form suitable for curated ear styling. Its scale makes it ideal for cartilage placements while maintaining a distinct visual identity.

Designed for Cartilage Placement

Created specifically for cartilage piercing, the design focuses on proportion and balance. The structured motif ensures that the zodiac pattern remains clear without appearing oversized. The setting is crafted to hold each diamond securely while maintaining a clean and streamlined silhouette against the ear.

Natural Diamond Detail

This earring features natural diamonds selected for their brilliance and clarity. When properly cared for, diamonds are suitable for daily wear and retain their appearance over time. The understated sparkle enhances the zodiac motif without overpowering the delicate cartilage placement.

High-Level Features

  • Pisces zodiac-inspired design with diamond accents.
  • Crafted for cartilage piercing with a balanced, minimal profile.
  • Available in the metal options specified in the product detail tables.
  • Suitable for single-ear styling or layered ear compositions.
Product Information
SKU SHP-BODYJ082410126
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.29 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-2X2 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs about: Diamond Pisces Zodiac Earring for Cartilage Piercing

Is this earring sold as a single piece or a pair?
Please refer to the product detail tables above for confirmation on whether this cartilage earring is sold individually or as a pair.
Is this earring suitable for everyday wear?
Diamond cartilage earrings are generally suitable for daily wear when handled with care. Regular cleaning and periodic checks help maintain the security of the setting.
What type of piercing is this designed for?
This piece is designed for cartilage placement. Please review the product specifications above to confirm gauge and post details before purchasing.
What metal options are available?
The available metal options are listed in the product detail tables above. Please refer to that section for accurate and updated information.
How should I clean and maintain this earring?
Clean gently with mild soap and warm water using a soft brush. Rinse thoroughly and dry with a lint-free cloth. Avoid harsh chemicals to help preserve the finish and setting.