Diamond Butterfly Earring for Cartilage Piercing

0
Regular price $589
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Delicate Accent for Cartilage Piercing

This diamond butterfly cartilage earring is designed for those who prefer subtle detail with personal meaning. The butterfly motif brings a soft, expressive touch, while the compact scale makes it suitable for cartilage piercings where comfort and proportion matter most.

Created for everyday wear, this piece is ideal for curated ear styling, whether worn alone or layered with other minimal studs.

Butterfly Design with Practical Setting

The butterfly shape is chosen for its gentle symmetry and visual lightness. Set with precision, the diamonds add controlled sparkle without overwhelming the ear.

The setting is designed to sit securely and close to the ear, helping maintain comfort throughout the day.

Diamond Choice for Small-Scale Jewelry

Diamonds are selected for their clarity and ability to reflect light even in compact designs. Their durability makes them well suited for jewelry intended for frequent wear in cartilage piercings.

High-Level Features

  • Butterfly-inspired cartilage earring design
  • Diamond-set detail for subtle sparkle
  • Proportioned for cartilage and upper-ear piercings
  • Designed for secure, everyday wear
Product Information
SKU SHP-BODYJ112310026
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.06 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-4 Pcs
Round-0.80X0.80 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs: Diamond Butterfly Cartilage Earring

Is this earring suitable for cartilage piercings?

Yes, this earring is designed specifically for cartilage and upper-ear piercings, with proportions suited for a secure and comfortable fit.

Can this earring be worn daily?

The design and materials make it suitable for regular wear when cared for properly and removed during high-impact activities.

Does this product include one earring or a pair?

This product is sold as a single cartilage earring. Please review the product page to confirm quantity before purchase.

What style of ear jewelry does this pair well with?

This piece pairs well with minimalist studs, small hoops, or other delicate cartilage earrings for a layered ear look.

Is the butterfly design purely decorative?

The butterfly design is primarily aesthetic, chosen for its symbolic and visual appeal while remaining compact for cartilage wear.