Cushion Cut 2.2 Carat Citrine Infinity Necklace with Silver Chain

0
Sale price $158 Regular price $198
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Brighten up your day with the warm glow of this stunning Citrine Infinity Necklace, designed to bring a touch of sunshine and joy to any outfit. Handcrafted in yellow gold plated silver, this Infinity Pendant features a radiant 8 MM cushion cut Citrine, securely held in claw setting. Known for its rich golden yellow hue, this AAA quality Citrine adds vibrant energy and a cheerful glow to your neckline. Above the center stone sits a graceful infinity motif, symbolizing everlasting love and hope. The infinity design is adorned with round brilliant cut lab grown diamonds, adding a touch of sparkle and enhancing the pendant’s elegant look. It also has a hidden bail, giving the pendant a seamless, floating look that keeps the focus on the stunning design. Dangling from a fine, comfortable chain, this Citrine and Diamond Necklace is perfect for everyday wear or special occasions. Whether you are heading to a brunch, celebrating a milestone, or gifting it to someone meaningful, it is a piece that feels personal and timeless.

Product Information
SKU RCPE062510110-FBA
Weight 3.70 gm (Approximate)
Center Stone Weight 2.23 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 1 Pieces
Total Weight 2.23 Carat (Approximate)
Dimension(approx) Cushion-8X8 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Cushion
Setting Type Claw-Set
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1X1 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade EF-VS
View More