Created Ruby and Diamond Chevron jewelry Set

0
Regular price $1,619
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Coordinated Jewelry Set with Modern Geometry

The Created Ruby and Diamond Chevron Jewelry Set is designed for those who prefer a cohesive and thoughtfully styled look. Featuring a matching design across pieces, the set brings together bold color and clean structure, making it suitable for both everyday wear and special occasions.

This set is ideal for buyers who value coordination without sacrificing individuality. The combination of ruby tones and diamond accents creates a balanced contrast, offering a refined yet expressive aesthetic.

Why the Chevron Design Stands Out

The chevron pattern is defined by its V-shaped structure, which introduces a sense of direction and movement into the design. This geometric form is often chosen for its ability to create a modern and structured appearance.

In a jewelry set, the chevron motif helps unify each piece, ensuring a consistent visual language. The angled design also enhances the way light interacts with the stones, adding depth and dimension.

The Appeal of Created Ruby with Diamond Accents

Created ruby offers a vivid and consistent color that brings warmth and richness to the design. Its bold tone serves as a focal point, making the jewelry visually striking without requiring additional complexity.

The stones are created without traditional mining, though environmental impact may vary depending on production methods and energy sources. Diamond accents introduce brightness, balancing the intensity of the ruby and enhancing the overall composition.

High-Level Features Buyers Appreciate

This jewelry set provides a coordinated look across multiple pieces, allowing for effortless styling. The combination of geometric structure and contrasting stones creates a design that feels both contemporary and versatile.

Each piece can be worn together for a complete look or separately to complement other jewelry. This flexibility makes the set suitable for a range of occasions and personal styling preferences.

Product Information
SKU SHP-PENDANT032215187
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 1.38 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 11 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Round-3X3 mm-5 Pcs
Round-2X2 mm-6 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 43 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-2 Pcs
Round-1.30X1.30 mm-20 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1X1 mm-20 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-necklace

FAQs About: Created Ruby and Diamond Chevron Jewelry Set

What is included in a jewelry set?
A jewelry set typically includes matching pieces designed to be worn together. The exact items included can be confirmed in the product detail section on the page.
What does a chevron design mean in jewelry?
A chevron design features a V-shaped pattern that adds structure and a modern geometric look to jewelry. It is often chosen for its clean lines and directional style.
Are created rubies real gemstones?
Created rubies are real gemstones produced in controlled environments. They share similar visual and physical properties with natural rubies while offering consistent color.
Can the pieces in this set be worn separately?
Yes. Each piece in the set can be styled individually or worn together, allowing for flexible and personalized styling options.
Is this set suitable for everyday wear?
The design makes it suitable for both daily wear and special occasions. With proper care, the pieces can maintain their appearance over time.
Who is this jewelry set best suited for?
This set is ideal for someone who prefers coordinated jewelry with a modern design. It appeals to buyers looking for a balanced combination of color, structure, and versatility.