Classic Diamond Solitaire Helix Piercing Earring

0
Sale price $417 Regular price $479
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Diamond Solitaire Helix Earring is the easiest way to look effortlessly elegant! This earring features a round diamond in the center of a round motif. Made in responsibly hallmarked metal for everyday wear. Style this Minimal Diamond Earring on your Helix, Cartilage, Tragus, Conch, or Upper Lobe Piercing, as the flat back closure will keep it intact in place. Designed to be worn up and around the ear, making it easy to wear and perfect to rock from day to night. To create a fashion-savvy look, pair this diamond piercing earring with gemstone studs or drops. This Helix Stud Earring shines luxuriously with a certified diamond that delivers outstanding brilliance, making your appearance truly remarkable. It is carefully handcrafted to enhance your ear and will come in a premium packaging box for safekeeping, along with a certificate of authenticity.

Product Information
SKU SHP-BODYJ082410041
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More