Certified Natural Citrine Designer Flower Engagement Ring with Diamond

0
Regular price $1,389
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Warm-Toned Engagement Ring with Floral Elegance

This certified natural citrine designer flower engagement ring is created for those who appreciate a softer, nature-inspired aesthetic. The floral design introduces a sense of delicacy, while the warm hue of the center stone adds a distinctive and inviting presence.

It offers an alternative to traditional engagement styles with a focus on individuality and subtle expression.

Floral Design with Thoughtful Structure

The flower-inspired setting is carefully arranged to create balance and visual harmony. Each element contributes to a cohesive design that feels detailed without becoming overly intricate.

This approach makes the ring suitable for those drawn to organic shapes with refined execution.

Citrine for Warm Character

The natural citrine brings a rich, golden tone that stands out from more conventional colorless stones. Its hue offers a sense of warmth and personality, making the ring feel both distinctive and approachable.

This makes it an appealing choice for those seeking something beyond traditional engagement options.

Diamond Accents for Subtle Brilliance

Diamond detailing is incorporated to enhance the overall design without overpowering the center stone. These accents provide a controlled level of sparkle, complementing the citrine’s color and the floral structure.

The result is a balanced interplay between brightness and warmth.

Designed for Comfortable Wear

The ring is crafted to sit comfortably on the finger, allowing for ease of wear throughout the day. Its balanced design supports both aesthetic appeal and practicality.

This makes it suitable for regular use while maintaining its refined appearance.

A Distinct Alternative to Traditional Rings

With its floral motif and warm-toned gemstone, this ring offers a different perspective on engagement jewelry. It is ideal for those who prefer designs that feel personal and expressive rather than conventional.

A thoughtful choice for marking meaningful moments with a unique touch.

Versatile Styling Appeal

The combination of structure and softness allows this ring to pair well with various jewelry styles. It can be worn as a standalone statement or complemented with additional bands depending on preference.

Its design ensures it remains adaptable across occasions and personal styles.

Product Information
SKU SHP-RINGS032224018
Width 9.7 mm
Height 4 mm
Weight 2.40 gm (Approximate)
Center Stone Weight 0.51 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-6 Pcs
Round-2.40X2.40 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
citrine-engagement-rings

Faq About: Certified Natural Citrine Designer Flower Engagement Ring with Diamond

What makes a flower engagement ring unique?
A flower design adds a nature-inspired element to the ring, creating a softer and more expressive look compared to traditional styles.
Is citrine suitable for everyday wear?
Citrine can be worn regularly with proper care, especially when the setting is designed to support durability.
How do diamond accents enhance this ring?
Diamond accents add a subtle level of brilliance, complementing the citrine without overshadowing its natural color.
Can this ring be paired with a wedding band?
Yes, it can be paired with a compatible band depending on the desired styling and fit.
Who is this ring best suited for?
It is ideal for individuals who prefer warm-toned gemstones and nature-inspired designs over traditional engagement rings.
Is this ring appropriate for gifting?
Yes, its unique design and meaningful style make it suitable for engagement or special occasion gifting.