Certified Moissanite Star Hoop Earrings

0
Regular price $1,769
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Modern Symbolism with a Subtle Edge

These certified moissanite star hoop earrings are created for those who prefer jewelry with a distinct yet refined character. The star motif introduces a sense of individuality while maintaining a composed and wearable design.

They are suited for everyday styling as well as occasions where understated detail makes a difference.

Hoop Structure with Thoughtful Proportion

The hoop form provides a balanced foundation, allowing the star element to stand out without disrupting the overall silhouette. This ensures the earrings feel cohesive rather than overly decorative.

The circular structure also contributes to a comfortable and secure wearing experience.

Design That Blends Movement and Stability

The combination of a structured hoop and a defined motif creates a controlled sense of movement. This enhances visual interest while maintaining stability during wear.

The result is a design that feels dynamic yet easy to style across different looks.

Moissanite with Considered Origin

Moissanite is valued for its consistent brilliance and suitability for frequent wear. It is created without traditional mining, and its impact varies by production and energy source.

This makes it a practical and thoughtful option for modern jewelry collections.

Versatile for Daily and Occasion Wear

With a design that balances simplicity and detail, these earrings transition easily from casual settings to more styled occasions. They can be worn alone or paired with other pieces without creating visual conflict.

This adaptability ensures long-term usability across different preferences.

Product Information
SKU SHP-EARRINGS082210081
Length 10 mm
Width 4.5 mm
Height 1.6 mm
Metal Weight 5.20 gm (Approximate)
Total Stone Weight 1.74 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 48 Pieces
Total Weight 1.74 Carat (Approximate)
Dimension(approx) Round-2X2 mm-8 Pcs
Round-1.60X1.60 mm-40 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings

Faq About: Certified Moissanite Star Hoop Earrings

Are hoop earrings comfortable for daily wear?
Yes, hoop earrings with balanced construction are designed for everyday comfort and ease of wear.
Do these earrings feel heavy?
The design focuses on maintaining a comfortable feel, allowing them to be worn for extended periods without discomfort.
Is moissanite suitable for regular use?
Moissanite is known for its durability and lasting brilliance, making it suitable for frequent wear.
Can these earrings be styled with other jewelry?
Their balanced design allows them to pair well with both minimal and statement jewelry pieces.
Are these suitable for gifting?
The distinctive star motif makes them a thoughtful option for gifting across various occasions.
How should I care for these earrings?
Gentle cleaning and proper storage will help maintain their shine and overall appearance over time.