Certified Moissanite Key to My Heart Necklace for Women

0
Regular price $1,559
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Designed to capture hearts and turn heads, this Key Pendant Necklace is a dazzling statement of love and style. At its center lies a brilliant 5 mm Heart Shape Moissanite set in 3 Prong Setting, sparkling like a tiny star and perfectly set within the elegant key design. The bow of the Key mirrors the heart motif, creating a charming, cohesive look that is both romantic and playful. Crafted with care, this Key Heart Necklace reflects light beautifully, giving you a subtle yet unforgettable shimmer with every movement. Whether you are dressing up for a special night out or adding a touch of sparkle to your everyday outfit, this Moissanite Pendant Necklace is versatile enough to complement any look. Presented in a stylish jewelry box, this Moissanite Diamond Necklace is ready to gift to someone special or keep as a treasured addition to your own collection. Perfect for anniversaries, birthdays, or just because, this necklace is a symbol of affection, thoughtfulness and timeless elegance. Comfortable to wear, this Moissanite Necklace for Women lets you carry a little piece of magic wherever you go, turning ordinary moments into sparkling memories. Make your style shine and let your heart speak with this exquisite moissanite key necklace.

Product Information
SKU SHP-PENDANT032214178
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.55 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.55 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
key-necklaces