Certified Moissanite Infinity Promise Ring

0
Sale price $295 Regular price $339
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Eternal elegance takes form in this beautifully crafted Moissanite Interlocked Ring, a timeless promise of unbreakable love and everlasting connection. Designed to symbolize unity, commitment, and eternity, this exquisite piece is the perfect choice for an anniversary gift or a meaningful Promise Ring. At the heart of the design lies an interlocked infinity symbol, adorned with brilliant round cut moissanite stones, expertly set in surface prong setting for maximum sparkle and a clean, modern finish. Each moissanite stone shines with D color and VS1 clarity, radiating fire and brilliance that rivals even the finest diamonds. The thoughtful use of the interlocking motif adds emotional depth, making this more than just a beautiful accessory. This Moissanite Promise Ring for Her is a symbol of your journey together, full of love, growth, and infinite possibilities. The ring's delicate yet striking design makes it ideal for everyday wear while still standing out on special occasions. Whether you are celebrating a milestone or simply showing your love to her, this Moissanite Infinity Ring is a meaningful and luxurious way to express a love that never ends, sparkling, strong, and deeply connected.

Product Information
SKU SHP-RINGS122035855
Width 2.2 mm
Height 6 mm
Metal Weight 2.32 gm (Approximate)
Total Stone Weight 0.25 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 62 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-1X1 mm-62 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-rings