Certified Moissanite Flower Stud Earrings with Screw Backs

0
Regular price $729
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Floral Elegance

The Certified Moissanite Flower Stud Earrings in Gold are designed to reflect softness and symmetry through a refined floral silhouette. The clustered arrangement forms a balanced flower motif that sits neatly on the ear.

This style is ideal for those who appreciate understated detailing with visible brilliance. The stud format keeps the look clean and structured, making it suitable for daily wear or subtle evening styling.

Floral Setting & Structure

The flower-inspired arrangement is crafted to create a cohesive shape, allowing each moissanite to contribute to the overall sparkle. The gold base enhances contrast while providing a classic fine jewelry finish.

Stud earrings are designed to rest securely against the earlobe, offering a composed appearance without movement.

Certified Moissanite Value

Moissanite is known for its durability and strong light performance, making it suitable for jewelry intended for consistent wear. Its optical properties create noticeable brilliance within a compact design.

Created without traditional mining, moissanite offers an alternative gemstone option, though impact varies by production and energy source.

High-Level Features

These earrings feature a floral stud silhouette set in gold and accented with certified moissanite. The combination of structured design and refined sparkle makes them versatile for gifting, daily styling, or special occasions.

Product Information
SKU SHP-EARRINGS082210146
Weight 1.20 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 8 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-2X2 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
stud-earrings

FAQs About: Certified Moissanite Flower Stud Earrings in Gold

Are flower stud earrings suitable for everyday wear?
Yes, the compact stud structure and balanced floral design make them practical and comfortable for regular use.
What makes moissanite a good choice for stud earrings?
Moissanite offers strong brilliance and durability, making it well suited for smaller designs that rely on light performance.
Do floral stud earrings sit flat on the ear?
Stud earrings are designed to sit close to the earlobe, providing a neat and secure appearance.
Are these earrings appropriate for gifting?
The floral motif and refined gold setting make them a thoughtful option for birthdays, anniversaries, or celebratory occasions.
How should I clean moissanite stud earrings?
Cleaning with mild soap, warm water, and a soft brush helps maintain sparkle. Regular inspection of the setting is also recommended.