Certified Moissanite Cat Pendant Necklace

0
Regular price $1,279
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Refined Tribute to Feline Charm

The Certified Moissanite Cat Pendant Necklace is designed for those who appreciate subtle symbolism and personal style. Inspired by the graceful outline of a cat, this pendant captures character in a polished, wearable form. It offers a meaningful accent without overwhelming the neckline, making it suitable for everyday styling or thoughtful gifting.

Cat Silhouette with Structured Setting

The design highlights a carefully shaped feline motif, accented with moissanite to introduce controlled brilliance. The setting is crafted to hold each stone securely while allowing light to enhance sparkle. The metal framework complements the contours of the cat form, balancing visual detail with refined structure.

Moissanite as a Practical Jewelry Choice

Moissanite is valued for its brightness and durability, making it appropriate for jewelry intended for regular wear. As a gemstone created without traditional mining, it provides an alternative choice; however, environmental impact varies by production and energy source. Certification information and technical specifications are available in the product detail tables above.

High-Level Features

  • Cat-inspired pendant design with moissanite accents.
  • Crafted in precious metal options listed in the specification table.
  • Certified moissanite with detailed information provided above.
  • Suitable for daily styling or meaningful gifting.
Product Information
SKU SHP-PENDANT072210162
Length 21.5 mm
Width 7.2 mm
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.13 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 14 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-11 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs about: Certified Moissanite Cat Pendant Necklace

Is this necklace suitable for everyday wear?
Yes, moissanite is known for its durability and brightness, making it appropriate for daily wear when handled with care and stored properly.
Does the pendant come with certification?
Certification details for the moissanite are provided in the product specification section. Please review the tables above for exact documentation information.
Is this pendant a good gift for cat lovers?
A cat-inspired pendant is often chosen as a personal and symbolic gift, especially for those who appreciate feline motifs and meaningful jewelry.
How should I clean this moissanite necklace?
Clean gently using mild soap and warm water. Rinse thoroughly, pat dry with a soft cloth, and store separately to maintain the metal finish and stone clarity.
Are metal options available for this necklace?
Available metal options are listed in the product detail tables above. Please refer to that section to review all current choices.