Certified Diamond Star Earring for Helix Piercing

0
Regular price $549
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Certified Diamond Star Earring for Helix Piercing is designed for the wearer who wants a small piece of jewelry with a bright celestial mood. Shaped as a star and set with round brilliant cut diamonds, this single helix earring adds a twinkling accent to cartilage, helix, or upper lobe styling without overpowering the rest of your ear stack.

Its flat back closure keeps the piece secure and practical for piercing wear, while the star motif brings a touch of charm, confidence, and personal expression. Whether chosen as a self-gift, a birthday surprise, a new-piercing upgrade, or a thoughtful gift for someone who loves celestial jewelry, this diamond star earring brings a polished sparkle to everyday styling and special plans alike.

Certified Diamond Star Earring for Helix Piercing with Round Brilliant Diamonds

This diamond star earring features 7 round brilliant cut diamonds with an approximate total weight of 0.18 carat. The diamonds are arranged in a pave setting across the star design, creating a compact celestial sparkle for helix, cartilage, or upper lobe placement. It is sold singly and available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, with flat back post length options from 4.5 MM to 7.5 MM.

What Makes This Special

  • Star-shaped diamond earring designed for helix, cartilage, or upper lobe piercing.
  • Features 7 round brilliant cut diamonds.
  • Total diamond weight is approximately 0.18 carat.
  • Each diamond measures approximately 1.50X1.50 mm.
  • Diamonds are listed as HI color and SI quality grade.
  • Pave setting creates a closely set sparkle across the celestial star motif.
  • Flat back closure helps keep the earring secure and comfortable for piercing wear.
  • Sold singly, with left ear and right ear selection available.
  • Approximate earring weight is 0.63 gm.
  • Available in 10K, 14K, and 18K yellow or white gold options.

Why Choose This Design

The star shape gives this helix earring a playful yet polished identity, making it ideal for someone who wants piercing jewelry with meaning and personality. Its compact diamond layout offers visible sparkle without feeling heavy, so it works beautifully as a single cartilage accent or as part of a layered ear stack.

The pave setting keeps the diamonds close together, creating a bright surface of light across the star. The flat back closure adds practical value for helix and cartilage placements because it sits more smoothly behind the ear than many traditional earring backs. With multiple post length options, the piece can be selected to better suit the wearer’s piercing placement and preferred fit.

Design Meaning

A star design often symbolizes guidance, hope, dreams, and the light someone carries with them. In this earring, the celestial shape is made more meaningful with certified diamonds, giving the piece a sense of sparkle that feels personal rather than purely decorative.

It can mark a new piercing, a fresh chapter, a birthday, a graduation, or a moment of self-celebration. Worn in the helix, cartilage, or upper lobe, the star becomes a small reminder of confidence, direction, and the joy of choosing jewelry that feels true to your own style.

Authenticity & Craftsmanship

This earring comes with a stone authenticity certificate from Rosec Jewels, giving you added confidence in the quality and details of your jewelry. It is crafted in precious metal and carefully checked by hand before being prepared for you.

The design features 7 round brilliant cut diamonds with an approximate total weight of 0.18 carat. The diamonds are listed as HI color and SI quality grade, set in a pave setting to create a delicate celestial sparkle across the star motif.

This earring is designed for piercing wear and everyday styling. Its precious metal finish and certified stones make it a refined choice for adding subtle sparkle to your look.

Style and Wearability

From the front, the star shape creates a bright celestial point on the ear, while the round diamonds add twinkle from different angles. From the side, the flat back design supports a smoother fit, making the earring suitable for helix, cartilage, and upper lobe placements.

Wear it alone as a delicate star accent or pair it with hoops, bar earrings, diamond studs, or other cartilage jewelry for a curated ear stack. Yellow gold options bring warmth to the diamonds, while white gold options create a crisp, bright finish. Since the earring is sold singly with left or right ear selection, it can be chosen specifically for the placement and styling plan you have in mind.

Product Information
SKU SHP-BODYJ082410089
Weight 0.63 gm (Approximate)
Center Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-7 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs About: Certified Diamond Star Earring for Helix Piercing

Is this diamond star earring suitable for a helix piercing?

Yes. This earring is designed for helix piercing and can also be worn in cartilage or upper lobe piercings. Its flat back closure helps keep the earring secure and comfortable for piercing placement.

How many diamonds are used in this star earring?

The earring features 7 round brilliant cut diamonds. The total diamond weight is approximately 0.18 carat, and each diamond measures approximately 1.50X1.50 mm.

What diamond quality is listed for this earring?

The diamonds are listed as HI color and SI quality grade with brilliant cut detailing. They are round in shape and arranged in a pave setting across the star motif.

Is this earring sold as a pair or a single piece?

This diamond star earring is sold singly. Rosec Jewels Offers left ear and right ear selection, allowing buyers to choose the piece for their intended piercing placement.

What does the star design symbolize?

The star design can symbolize guidance, hope, dreams, and personal light. In this earring, the diamond-set star adds a sparkling celestial accent that can mark a new piercing, a milestone, or a personal style statement.

What metal options are available for this diamond helix earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. These options allow buyers to choose either a warm yellow gold tone or a bright white gold finish.

How should I care for this diamond star helix earring?

Clean the earring gently with mild soap, warm water, and a soft brush, then dry it with a lint-free cloth. Avoid harsh chemicals and store it separately when not in use. For piercing wear, keep the flat back and post clean and make sure the closure is secure before wearing.