Certified Diamond Snake Earring for Cartilage Piercing

0
Regular price $479
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Highlight the boldness and mystery with our Diamond Snake Earring. Unique and trendy!

  • Crafted with precision, this stunning piercing earring features captivating certified Diamonds studded on a snake motif in prong setting.
  • The Animal Earring embraces a unique and edgy look with its gothic inspired design. This stunning earpiece is perfectly suited for Helix and Cartilage piercings.
  • It comes with a comfortable flat back closure and pairs beautifully with various outfits, adding a playful touch.
  • Combining modern and bold vibes, it radiates luxury and sophistication. This Serpent Earrings is a piece of designer and meaningful jewelry and features a detailed design that catches the eye while maintaining an elegant feel.
  • Exude mystique with this Diamond Cartilage Earring, a striking addition to your ear stack collection. It is ideal for those who seek unconventional beauty and a touch of enigmatic.
  • So, pick up this Unique Diamond Earring for your loved ones as a Birthday Gift, Anniversary Gift, Graduation Gift, or Christmas Gift.
Product Information
SKU SHP-BODYJ052310093
Length 11.8 mm
Width 5.5 mm
Height 1.4 mm
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.19 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-15 Pcs
Round-1.20X1.20 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1X1 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More