Certified Diamond Aries Zodiac Constellation Earring for Helix Piercing

0
Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Personal Symbol in a Celestial Form

The Certified Diamond Aries Zodiac Constellation Earring for Helix Piercing is designed for those who want their jewelry to reflect personality and meaning. Inspired by the Aries constellation, this piece translates a zodiac symbol into a refined, wearable design suited specifically for helix placement.

Designed for Helix Piercing

Crafted for cartilage wear, the earring is proportioned to sit comfortably along the helix. Its structured setting keeps the diamond accents aligned in a constellation pattern while maintaining a secure fit. The scale and form are intended to complement curated ear styling without overpowering other pieces.

Certified Diamond Detailing

The diamonds used in this earring are certified as specified in the product details above. When properly set and maintained, diamonds are suitable for everyday wear. Certification confirms the stated characteristics and offers clarity regarding the quality of the stones.

High-Level Features

  • Aries zodiac constellation motif formed with diamond accents.
  • Designed specifically for helix cartilage piercing.
  • Certified diamonds for documented quality assurance.
  • Metal options and technical specifications listed in the product detail tables above.
Product Information
SKU SHP-BODYJ082410130
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.19 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-2X2 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs about: Diamond Aries Zodiac Constellation Helix Earring

Is this earring sold as a single piece or a pair?
The listing details specify whether the earring is sold individually or as a pair. Please refer to the product information section for confirmation before purchasing.
Is this earring suitable for cartilage piercings?
Yes, this design is created specifically for helix placement. Its size and structure are intended for cartilage wear rather than standard lobe piercings.
Does the earring come with diamond certification?
Certification details for the diamonds are provided in the product specification section, confirming their stated characteristics.
Can this Aries earring be worn daily?
Diamonds are durable and suitable for regular wear when properly set. Routine cleaning and periodic checks help maintain the appearance and security of the piece.
Is this earring a meaningful gift for someone born under Aries?
The Aries constellation motif makes this piece a symbolic gift for individuals who identify with the Aries zodiac sign or appreciate celestial-inspired jewelry.