Certified 2.58 Carat Oval Cubic Zirconia Statement Flower Earrings for Women

0
Regular price $128
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Designed to stand out on special days, these CZ Drop Earrings are made for moments when you want your look to feel complete. Curated for weddings, cocktail events, and celebrations, they bring a statement vibe that instantly upgrades any outfit. The design features a 6X8 MM oval shape zircon of AAAAA quality, beautifully placed within an intricate floral pattern. The Cubic Zirconia Earrings are embellished with interlocked detailing, creating a layered flower motif studded with smaller stones for added sparkle. A stone-studded bar at the top connects to the drop, giving the Flower Drop Earrings a structured yet flowing look. Crafted in 14K white gold plated silver, they are made for durability while still feeling comfortable enough for long hours of wear. Even with their bold design, they sit well on the ears and don’t feel too heavy. Screw-back closures keep them secure, making them a reliable choice for long events like weddings or parties. Whether styled with bridal wear or an evening outfit, these Wedding Earrings for Bride add that extra detail that pulls the whole look together. Delivered in a signature jewelry box, they are ready for gifting or keeping safe.

Product Information
SKU RCEA112410014-FBA
Weight 5.00 gm (Approximate)
Center Stone Weight 2.58 Carat (Approximate)
ZIRCON-5A INFORMATION
No.of Stones 166 Pieces
Total Weight 3.70 Carat (Approximate)
Dimension(approx) Oval-6X8 mm-2 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1.60X1.60 mm-2 Pcs
Round-1.80X1.80 mm-4 Pcs
Round-1.90X1.90 mm-2 Pcs
Round-1X1 mm-144 Pcs
Round-2.20X2.20 mm-2 Pcs
Round-2X2 mm-2 Pcs
Color White
Cut Brilliant
Shape Oval, Round
Setting Type Prong-Setting
Quality Grade AAAAA
View More