Certified 2.5 Carat Lab Grown Diamond Heart Drop Earrings

0
Regular price $1,869
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate love and romance with these breathtaking Heart Drop Earrings, ideal for a bride on her special day. The design features a captivating prong set 7MM heart shape diamond (lab created) as a centerpiece, surrounded by a delicate round cut diamond halo. Above the main stone, two dainty bezel set diamonds are set with an open heart motif adorned with small stones. The drop style allows the Diamond Heart Earrings to sway beautifully with every movement, making them a mesmerizing addition to any jewelry collection. Handcrafted with precision, the secure lever back closure ensures a comfortable and snug fit, allowing you to wear them effortlessly throughout the day. They are ideal as Bridal Earrings or a thoughtful Anniversary Gift for Her.

Product Information
SKU SHP-EARRINGS022510035
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 2.88 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 64 Pieces
Total Weight 2.88 Carat (Approximate)
Dimension(approx) Heart-7X7 mm-2 Pcs
Round-1.10X1.10 mm-58 Pcs
Round-1.20X1.20 mm-4 Pcs
Color White
Cut Brilliant
Shape Heart, Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More