Cartilage Flower Crawler Earring with Diamond

0
Sale price $478 Regular price $549
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Floral Detail for Curated Ear Styling

The Cartilage Flower Crawler Earring with Diamond is designed for those who appreciate delicate structure with visible presence. Its floral motif follows the natural curve of the ear, creating a refined crawler effect that adds dimension without overwhelming your overall look. Ideal for cartilage placements, this piece suits curated ear stacks and standalone styling alike.

Crawler Structure with Secure Placement

Unlike traditional studs, a crawler earring is crafted to align along the ear rather than sit at a single point. The floral arrangement is thoughtfully structured to provide balance across the cartilage area while maintaining a stable and secure fit. Specific details regarding setting style, dimensions, metal options, and fastening type are outlined in the product tables above.

Diamond Accent Value

The diamond accents add subtle brilliance to the floral design, enhancing the overall silhouette without excessive sparkle. Diamonds are known for their durability, making them appropriate for regular wear when cared for properly. Complete stone specifications are provided in the product detail tables above.

High-Level Features

  • Floral crawler design shaped to follow the ear’s natural curve.
  • Diamond accents for refined brilliance.
  • Structured setting crafted for balance and stability.
  • Metal options and technical details specified in the tables above.
Product Information
SKU SHP-BODYJ082410004
Length 15 mm
Width 7.5 mm
Height 2 mm
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.74 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.74 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-5 Pcs
Round-1.70X1.70 mm-8 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Flower Cartilage Crawler Earring

Is this earring sold as a single piece or a pair?
The product listing specifies what is included with purchase. Please refer to the product details section above for confirmation.
Is this suitable for cartilage piercings?
This design is created as a crawler style intended for cartilage placement. Fit and comfort may vary depending on individual piercing position.
Are the diamonds natural?
The stone type and origin are specified in the product detail tables above. Please review the stone information section for full clarity.
What metal options are available?
Available metal types and finishes are listed in the product specification tables above.
Can this be worn daily?
Diamonds are durable and suitable for regular wear. Proper handling and routine cleaning help maintain appearance over time.