Black Onyx and Diamond Infinity Promise Ring

0
Regular price $1,029
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Some designs speak straight to the heart, this Black Onyx Infinity Ring is one of them. Made to reflect the strength and beauty of a lasting bond, it features two pear cut black onyx stones, each held securely in prongs. Between them flows a soft curve of round cut diamonds, forming an elegant infinity shape. The two black onyx stones represent two lives, two hearts, or two paths coming together. Whether it is a promise to a partner, a gift to someone special, or a reminder of your own journey, this Two Stone Ring carries a quiet but powerful message of connection and unity. The contrast between the AAA quality black onyx and the bright shimmer of HI-SI quality diamonds creates a look that is balanced and refined, offering both beauty and symbolism. Every detail in this Infinity Promise Ring is placed with care, making it not just an accessory but a piece with a story. Its minimalist style fits effortlessly into any wardrobe, while the infinity motif gives it emotional depth and timeless appeal. Perfect as a Promise Ring, a symbol of partnership, or a thoughtful gift for yourself, this Black Onyx and Diamond Ring is a meaningful expression of love, trust, and the bonds that last.

Product Information
SKU SHP-RINGS032221887
Metal Weight 1.76 gm (Approximate)
Total Stone Weight 0.49 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 2 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Black
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.50X1.50 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings