Baguette London Blue Topaz Eternity Anniversary Band with Diamond

0
Regular price $1,409
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elegant and radiant, this Half Eternity Band seamlessly combines timeless style with everyday comfort. The front of the Eternity Wedding Band showcases a stunning arrangement of baguette cut London Blue Topaz alternatively set with round cut diamond stones. The baguette blue topaz stones impart a contemporary aesthetic, while the round diamond stones contribute a dazzling brilliance. These two shapes are arranged in an alternating sequence, producing a delightful rhythm of sparkle across the surface. The reverse side of the Wedding Anniversary Band is smooth and unadorned, ensuring exceptional comfort for all-day wear. Whether you are engaged in desk work, enjoying a night out, or simply unwinding, this Wide Eternity Ring feels light and effortless on your finger. This Blue Topaz Wedding Band is an excellent option for various occasions. It serves beautifully as a modern wedding band, a meaningful anniversary present, or a chic stackable ring. You can wear it solo to allow it to shine independently or combine it with your engagement ring for a complete and glamorous bridal appearance. This Real London Blue Topaz Ring represents a wonderful blend of luxury and comfort, making it a piece you will desire to wear daily.

Product Information
SKU SHP-RINGS032225011
Metal Weight 2.24 gm (Approximate)
Total Stone Weight 1.18 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 6 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Baguette-2X4 mm-6 Pcs
Color Blue
Cut Brilliant
Shape Baguette
Setting Type Bar-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-2X2 mm-7 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bar-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-women-wedding-bands