Animal Inspired Diamond Bird Earring for Helix Piercing

0
Regular price $709
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Unique Accent for Curated Ear Styling

The Animal Inspired Diamond Bird Earring for Helix Piercing is designed for those who want their jewelry to reflect individuality and detail. The bird motif introduces a sense of movement and character, making it a distinctive addition to curated ear looks.

This piece is ideal for buyers seeking a small yet expressive earring that stands apart from traditional shapes while remaining easy to wear.

Why the Bird Design Works for Helix Placement

The bird-inspired form is shaped to follow the natural curve of the ear, allowing it to sit comfortably along the helix. Its structure creates a sense of flow while maintaining a compact profile.

This design approach helps balance visual detail with practicality, ensuring the earring feels secure and proportionate.

Diamond Detail and Everyday Suitability

Diamonds are valued for their brightness and durability, making them well suited for small, close-fitting jewelry. Their presence adds subtle sparkle that enhances the design without overwhelming it.

This makes the earring appropriate for regular wear, especially in piercings where comfort and low profile are important.

High-Level Features Buyers Appreciate

The compact structure ensures the earring remains comfortable throughout the day, while its defined shape adds character to the overall look. Its design allows it to be worn as a standalone piece or combined with other earrings.

It works well within layered ear styling, offering flexibility for those who like to mix shapes and placements for a personalized aesthetic.

Product Information
SKU SHP-BODYJ082410080
Length 6.5 mm
Width 14 mm
Height 3 mm
Metal Weight 1.30 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-2.70X2.70 mm-1 Pcs
Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Animal Inspired Diamond Bird Earring for Helix Piercing

Is this earring specifically designed for helix piercing?
Yes, its shape and size are intended to fit comfortably along the helix area while maintaining a secure and balanced position.
Is this sold as a single earring or a pair?
Helix earrings are typically sold as single pieces, but it is recommended to confirm this in the product details section.
Is it comfortable for daily wear?
Its compact and low-profile design makes it suitable for everyday wear when used in a healed piercing.
Can it be worn in other piercings?
Depending on the fit, it may be worn in other ear piercings, though it is specifically designed for helix placement.
Are diamonds suitable for piercing jewelry?
Diamonds are durable and maintain their appearance over time, making them a practical choice for everyday piercing jewelry.
Who is this earring best suited for?
It is ideal for those who prefer unique, nature-inspired designs that add personality to curated ear styling.