Marquise Moissanite Butterfly Cartilage Earring

0
Regular price $389
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Detail for Curated Ear Styling

The Marquise Moissanite Butterfly Cartilage Earring is designed for those who appreciate subtle symbolism and refined sparkle. Its compact butterfly silhouette makes it especially suitable for helix and cartilage piercings, where proportion and balance matter. Whether worn alone or paired with additional studs and hoops, it adds a thoughtful accent without overwhelming your look.

Butterfly Form with Structured Precision

The butterfly motif is formed using marquise-shaped stones arranged to create soft symmetry. This structured layout enhances light reflection while maintaining a clean outline. The setting is crafted to sit close to the ear, helping maintain stability and comfort for everyday wear.

Moissanite Brilliance for Everyday Sparkle

Moissanite is valued for its bright light performance and durability, making it suitable for daily wear when properly cared for. Created without traditional mining, moissanite offers an alternative to mined gemstones, though overall environmental impact varies by production and energy source. Its brilliance complements the delicate scale of cartilage jewelry while remaining refined.

High-Level Features

  • Butterfly design crafted with marquise moissanite stones.
  • Compact size suitable for helix and cartilage piercings.
  • Designed for secure placement and close-to-ear comfort.
  • Available metal options and complete specifications are listed in the product tables above.
Product Information
SKU SHP-BODYJ072210045
Length 4 mm
Width 5.2 mm
Height 1.5 mm
Metal Weight 0.26 gm (Approximate)
Total Stone Weight 0.09 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 4 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Marquise Moissanite Butterfly Cartilage Earring

Is this earring sold as a single piece or a pair?
This product page specifies whether the earring is sold individually or as a pair. Please refer to the product details section for confirmation before purchase.
Is this suitable for helix and cartilage piercings?
Yes, the compact butterfly design is intended for cartilage placements such as the helix. Always ensure your piercing is fully healed before changing jewelry.
Can I wear this earring every day?
Moissanite is durable and suitable for everyday wear with proper care. Regular cleaning and gentle handling help maintain its brilliance over time.
What metal options are available?
Available metal options are listed on the product page. Please review the selection menu and specification table for accurate information.
Where can I find stone size and other specifications?
Complete measurements, stone details, and additional specifications are provided in the product detail tables above.