2 CT Lab Grown Ruby Heart Pendant Necklace with Moissanite

0
Regular price $1,049
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Romantic Heart Ruby Pendant Necklace

This 2 CT Lab Grown Ruby Heart Pendant Necklace presents a meaningful design centered around a heart-shaped ruby. The vivid red gemstone serves as the focal point of the pendant, creating a striking expression of color and elegance. Its heart silhouette introduces a symbolic element that is often associated with affection and emotional connection.

Moissanite accents complement the ruby centerpiece, adding delicate brilliance that enhances the overall appearance of the necklace. The combination of vibrant gemstone color and refined sparkle creates a balanced and graceful jewelry piece.

Heart-Shaped Design with Elegant Detail

The pendant’s heart shape provides a distinctive and expressive silhouette. This classic motif has long been associated with love and meaningful occasions, making it a popular choice for necklaces intended to mark memorable moments.

The design carefully frames the ruby centerpiece while allowing the gemstone’s color to remain the visual highlight. Moissanite accents introduce subtle brilliance that enhances the pendant without overwhelming the central stone.

The Beauty of Lab Grown Ruby

Rubies are admired for their vibrant red color and timeless presence in fine jewelry. The heart-shaped cut enhances the gemstone’s visual character while emphasizing its symbolic design.

Lab grown ruby is created without traditional mining. As with all lab-created gemstones, environmental impact can vary depending on production processes and energy sources.

A Necklace for Meaningful Moments

Heart-shaped pendants are often chosen to celebrate meaningful milestones such as anniversaries, birthdays, or personal celebrations. Their symbolic form combined with vibrant gemstone color creates a piece that feels both expressive and timeless.

With its elegant gemstone centerpiece and refined detailing, this pendant necklace offers a graceful jewelry design suitable for both everyday styling and special occasions.

Product Information
SKU SHP-PENDANT122035481
Length 16.7 mm
Width 8 mm
Metal Weight 2.56 gm (Approximate)
Total Stone Weight 2.18 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-1 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
valentines-day-gifts

FAQs About: 2 CT Lab Grown Ruby Heart Pendant Necklace with Moissanite

What does a heart-shaped pendant symbolize?
Heart-shaped pendants are commonly associated with love, affection, and meaningful connections. They are often chosen as gifts for special occasions.
What is a lab grown ruby?
A lab grown ruby is created in controlled environments to replicate the visual and physical characteristics of natural ruby gemstones used in jewelry.
What is moissanite used for in jewelry?
Moissanite is valued for its brilliance and clarity. It is often used as accent stones in jewelry designs to introduce additional sparkle.
Can a ruby pendant necklace be worn daily?
Many gemstone pendants are designed for everyday wear. With proper care, necklaces with gemstones can maintain their appearance when worn regularly.
Is a ruby pendant suitable as a gift?
Ruby jewelry is often selected as a gift because of its vibrant color and symbolic associations with passion and affection.
Can this necklace be layered with other jewelry?
Yes, pendant necklaces are commonly layered with other chains or necklaces to create a personalized jewelry style.