18 Carat Emerald Cut Lab Grown Pink Sapphire Statement Earrings for Wedding

0
Regular price $220
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A timeless gem for the woman who wishes to radiate on special occasions, these Dangle Drop Earrings perfectly combine elegance and sparkle. They showcase 10X14 MM emerald cut lab grown pink sapphire at the center, set in prong setting with a round cut moissanite halo. Above this stunning centerpiece, a brilliant oval-shaped motif is adorned with delicate round cut moissanite stones, enhancing its charm and brilliance. Handcrafted from 14K white gold plated silver, these Bridal Dangle Earrings reflect a commitment to meticulous craftsmanship and detail. Designed for versatility, these Pink Sapphire Earrings are the perfect choice for bridal attire, extraordinary celebrations, or even as a sophisticated statement piece for elegant evenings. The difference between the AAAA quality lab created pink sapphire and the vibrant D-VS1 quality Moissanite gives a striking yet well-balanced appearance. Made for comfort, the secure screw back closures provide a reliable fit from day to night. These Pink Sapphire and Moissanite Earrings are a flexible addition to any jewelry collection. They come beautifully packaged in an elegant jewelry box, ready for gifting or safe storage.

Product Information
SKU RCEA022510060-FBA
Weight 9.00 gm (Approximate)
Center Stone Weight 18.00 Carat (Approximate)
LAB CREATED PINK SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 18.00 Carat (Approximate)
Dimension(approx) Emerald Cut-10X14 mm-2 Pcs
Color Pink
Cut Brilliant
Shape Emerald Cut
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 88 Pieces
Total Weight 3.43 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Round-2.50X2.50 mm-2 Pcs
Round-2X2 mm-48 Pcs
Round-3X3 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More