1 Carat Lab Grown Blue Sapphire Leaf Earrings with Moissanite

0
Sale price $115 Regular price $164
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These stunning Sapphire Leaf Earrings beautifully blend elegance and shine, making them ideal for everyday use or special occasions. Crafted from sterling silver and plated with 14k white gold, they amplify the hue and brilliance of each lab-created blue sapphire. At the center of these Silver Stud Earrings is a 4X6 MM pear-shaped lab-made blue sapphire, elegantly set in a classic prong setting. They are complemented by delicate round brilliant-cut moissanite stones. The unique metal curve motif draws attention to the core of the design. These Lab Grown Blue Sapphire Earrings are the perfect example of subtle elegance, classy style, and timeless charm, guaranteed to catch the attention of even the pickiest observers. These Everyday Stud Earrings feature a secure screw back closure that guarantees both comfort and safety. AAAA quality lab-grown blue sapphire provide the same beauty and elegance as natural stones, yet they are more eco-friendly and budget-friendly, allowing you to enjoy luxury without compromise. These Leaf Stud Earrings include a certificate of authenticity to guarantee their quality and value. Elegantly packaged in a premium gift box, these Sapphire and Moissanite Earrings make a considerate gift for birthdays, anniversaries, Valentine’s Day, wedding days, or any special occasion.

Product Information
SKU RCEA042157664-FBA
Length 11.3 mm
Width 5.5 mm
Weight 1.60 gm (Approximate)
Center Stone Weight 1.00 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 1.00 Carat (Approximate)
Dimension(approx) Pear-4X6 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 34 Pieces
Total Weight 0.11 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-22 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
stud-earrings