Womens Moissanite Designer Engagement Ring in Silver

0
Sale price $120 Regular price $150
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Looking for something that surprises your lady, here we have got your back with the Moissanite Engagement Ring. This Non Traditional Engagement Ring features a bow motif, which is studded with Moissanites and holds dangling pear shape Moissanite secured in Prong Setting. This Designer Engagement Ring represents Love, Commitment, and Devotion, which makes it a perfect choice to experience love. The ring shines with the adorable shine of D-VS1 Quality Moissanite studded in the ring. Present this knot ring to your special one and experience a priceless moment with her. It is not just a beautiful design, it is a significant piece that represents friendship, love, or a commitment to yourself. Simple, sweet, and rich in meaning, it is something you will enjoy wearing daily. At Rosec Jewels, every item is meticulously handcrafted and includes a gemstone authentication certificate, guaranteeing quality and authenticity. Plus, this Bow Ring comes in a stylish jewelry box, perfect for gifting or keeping as a personal treasure. The ring’s striking design balances chic style with meaningful sentiment, making this Unique Engagement Ring ideal for someone who wants their engagement ring to be as unique and memorable as their love story. This is more than just an engagement ring, it is a symbol of love and individuality, crafted to be treasured for a lifetime.

Product Information
SKU RCRI082410014-FBA
Width 9.8 mm
Height 2.5 mm
Metal Weight 5.41 gm (Approximate)
Total Stone Weight 0.90 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 188 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Pear-2.50X4.00 mm-1 Pcs
Round-1.10X1.10 mm-13 Pcs
Round-1X1 mm-14 Pcs
Round-0.90X0.90 mm-139 Pcs
Round-0.80X0.80 mm-21 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More