Vintage Style Moonstone and Diamond Flower Engagement Ring

0
Regular price $1,769
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Romantic Floral Design with Vintage Influence

This vintage style moonstone and diamond flower engagement ring captures the charm of antique-inspired craftsmanship with a delicate floral motif. The flower design centers around a luminous moonstone, creating a soft and romantic focal point.

Ideal for someone who appreciates symbolic, nature-inspired jewelry, this ring blends graceful detailing with expressive individuality.

Flower Setting with Diamond Accents

The floral arrangement frames the moonstone with diamond accents, enhancing light reflection while preserving the gentle glow of the center stone. The vintage styling is reflected in the intricate structure and carefully balanced proportions.

This combination of detailed metalwork and accent stones creates dimension without overwhelming the central design.

Moonstone’s Natural Luminosity

Moonstone is admired for its soft sheen and subtle play of light, often appearing to glow from within. Its ethereal quality makes it a meaningful alternative to more traditional engagement gemstones.

With mindful wear and proper care, moonstone can be enjoyed in engagement jewelry that prioritizes aesthetic beauty and distinctive character.

High-Level Features

This engagement ring features a moonstone center set within a vintage-inspired flower design accented by diamonds. The composition emphasizes romantic symbolism, gentle luminosity, and intricate detailing suited to a nature-inspired engagement style.

Product Information
SKU SHP-RINGS0821201466
Width 6.2 mm
Height 8 mm
Metal Weight 4.60 gm (Approximate)
Center Stone Weight 0.85 Carat (Approximate)
MOONSTONE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color light blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
solitaire-engagement-rings

FAQs About: Vintage Moonstone Flower Ring

What gives this ring its vintage style appearance?
The vintage style comes from the floral motif, intricate detailing, and the balanced use of accent stones that evoke antique-inspired craftsmanship.
Why is moonstone chosen for engagement rings?
Moonstone is appreciated for its soft, luminous glow and unique character, making it appealing to those seeking a romantic and unconventional center stone.
How do diamonds enhance the floral design?
Diamond accents add brightness and contrast, outlining the flower shape while enhancing the overall brilliance of the ring.
Is moonstone suitable for regular wear?
Moonstone can be worn regularly with proper care. Mindful wear and routine maintenance help preserve its surface and appearance over time.
What type of wedding band pairs well with this floral ring?
A slim band or a gently contoured band often complements the floral design, allowing the engagement ring to remain the focal point.