Vintage Style 1 Carat Emerald Cut Fire Opal Necklace with Diamond

0
Sale price $139 Regular price $198
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Turn up the heat on your style with this radiant Fire Opal Necklace, designed to brighten every occasion with its fiery charm. Handcrafted in yellow gold plated silver, this Vintage Art Deco Necklace features a captivating 5X7 MM emerald cut Fire Opal in prong setting. Surrounding the center stone is a shimmering halo of lab grown diamonds, adding a layer of brilliance that enhances the richness of the opal. Above the halo, a delicate flower motif adorned with sparkling round lab diamonds brings a soft, feminine touch to this bold design. The combination of AAA quality Fire Opal and EF-VS quality lab grown diamonds offers exceptional color, clarity, and sparkle, a match made in gemstone heaven. Suspended from a sleek chain, this Opal Bridal Necklace sits beautifully on the neckline, catching the light and admiration with every move. As the October birthstone, Fire Opal also makes a thoughtful gift for birthdays, anniversaries, or any special milestone. Delivered in a signature jewelry box, this Fire Opal and Diamond Necklace is ready to be treasured, a glowing symbol of beauty, strength, and individuality.

Product Information
SKU RCPE062510046-FBA
Weight 3.30 gm (Approximate)
Center Stone Weight 1.10 Carat (Approximate)
FIRE OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 1.10 Carat (Approximate)
Dimension(approx) Emerald Cut-5X7 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Emerald Cut
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 33 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-1 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1X1 mm-31 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More