Solitaire Lab Grown Diamond Flower Ring

0
Sale price $347 Regular price $399
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Floral-Inspired Solitaire Design

The Solitaire Lab Grown Diamond Flower Ring blends classic brilliance with a soft floral motif. Designed around a single center diamond, the setting draws inspiration from blooming petals, offering a distinctive yet timeless aesthetic.

Elegant Flower Setting

The flower-inspired design frames the solitaire diamond in a way that enhances its presence while adding gentle visual detail. This approach allows the center stone to remain the focal point, while the sculpted form introduces character and dimension. The structure is crafted to balance beauty with secure everyday wear.

About Lab Grown Diamonds

Lab grown diamonds have the same physical and optical properties as mined diamonds. They are created without traditional mining, though their overall impact varies by production and energy source. Known for durability and lasting brilliance, they are well suited for engagement and daily wear rings.

Key Highlights

  • Lab grown solitaire diamond: classic brilliance with modern sourcing.
  • Flower-inspired setting: delicate detailing around the center stone.
  • Timeless engagement style: balances tradition and individuality.
  • Available in multiple metal options: select your preferred finish on the product page.
Product Information
SKU SHP-RINGS082310213
Metal Weight 2.87 gm (Approximate)
Total Stone Weight 0.46 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.46 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade VS
View More

Product Parent Collection Handle
lab-created-diamond-rings
Is the diamond in this ring lab grown?
Yes, this ring features a lab grown diamond that shares the same physical and optical properties as a mined diamond.
What makes the design a flower ring?
The setting is crafted with petal-inspired detailing around the solitaire diamond, creating a subtle floral appearance.
Is a lab grown diamond durable for daily wear?
Lab grown diamonds are highly durable and suitable for everyday wear when properly cared for and periodically inspected.
Can I choose different metal options?
Available metal options can be selected directly from the customization section on the product page.
How should I clean this diamond ring?
Clean gently with mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals to help preserve the metal and maintain the diamond’s brilliance.