Round Cut Moissanite Seven Stone Curved Necklace

0
Regular price $1,279
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Seven Stone Moissanite Curved Necklace

This necklace features a graceful curved arrangement of seven round cut moissanite gemstones set in a gentle arc. The design allows each stone to align smoothly across the neckline, creating a balanced visual flow while maintaining a refined jewelry silhouette.

The curved structure helps distribute the gemstones evenly, producing a design that highlights symmetry and continuous sparkle across the center of the necklace.

Curved Necklace Design

A curved necklace setting positions gemstones along a slightly arched line so that the stones follow the natural contour of the neckline. This arrangement allows the necklace to sit smoothly while maintaining visual balance across the design.

The arc formation also helps each gemstone remain visible when worn, ensuring that the central section of the necklace captures attention without appearing overly structured.

Round Cut Moissanite Gemstones

The necklace showcases round cut moissanite stones, a gemstone cut known for its symmetrical faceting and bright light reflection. Round cuts are frequently used in jewelry because they allow light to reflect evenly across the stone's surface.

Moissanite gemstones are created without traditional mining processes. Environmental impact can vary depending on production methods and energy sources.

Balanced Multi-Stone Jewelry Style

Seven-stone jewelry designs are often chosen for their balanced gemstone layout. Placing multiple stones in sequence allows the design to highlight individual brilliance while maintaining a cohesive structure.

In this necklace, the sequence of round cut gemstones and the curved arrangement work together to create a refined piece that blends gemstone brilliance with smooth metal craftsmanship.

Product Information
SKU SHP-PENDANT072210030
Length 5.5 mm
Width 16.5 mm
Weight 3.12 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.63 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Round Cut Moissanite Seven Stone Curved Necklace

What is a curved necklace design?
A curved necklace features gemstones arranged along a gentle arc so the stones follow the natural shape of the neckline.
What does a seven stone necklace represent?
A seven stone necklace features multiple gemstones set in sequence to create a balanced jewelry design that highlights consistent sparkle.
Why are round cut gemstones used in necklaces?
Round cut gemstones are widely used in jewelry because their symmetrical facets allow light to reflect evenly across the stone.
What is moissanite used for in jewelry?
Moissanite is used in jewelry because of its bright brilliance and reflective properties that enhance gemstone designs.
Why choose a multi-stone necklace design?
Multi-stone necklaces allow several gemstones to be displayed together, creating a balanced design that highlights repeated brilliance.
What makes curved necklaces different from straight bar necklaces?
Curved necklaces follow the natural contour of the neckline, while straight bar necklaces feature gemstones arranged in a horizontal line.