Real 0.8 Carat Rhodolite Drop Earrings with Lab Diamond for Women

0
Sale price $209 Regular price $298
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Exquisite and romantic, these Vintage Wedding Earrings are designed for the bride who values classic elegance with a touch of flair. Handcrafted in 14k yellow gold plated silver, each earring centers around a glowing 4X5 MM oval cut Rhodolite, cradled in a secure claw setting. Surrounding the central stone is a dazzling halo of round lab grown diamonds. These Rhodolite and Diamond Earrings are really special because they have a beautiful petal shaped halo around the center stone. Each petal is carefully designed with sparkling lab grown diamonds and tiny beaded details, giving the earrings a lovely vintage look with extra charm and depth. Above the main design, tiny diamond studded motif connect the main drop to the ear, providing graceful movement and extra sparkle that dances with you. With AAA quality Rhodolite and EF-VS quality lab grown diamonds, the Dangle Drop Earrings dazzle both in color and clarity, modern gemstones with old-world charm. Plus, the screw back closure ensures comfort and security so you can wear them all day, from your wedding to the after-party.

Product Information
SKU RCEA112114662-FBA
Length 17.2 mm
Width 4 mm
Height 1.5 mm
Weight 2.90 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
RHODOLITE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Oval-4X5 mm-2 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Claw-Set
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 100 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-22 Pcs
Round-0.90X0.90 mm-42 Pcs
Round-1.10X1.10 mm-14 Pcs
Round-1.30X1.30 mm-22 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade EF-VS
View More