Pave Set Moissanite Designer Teardrop Bar Necklace

0
Sale price $295 Regular price $339
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The 1 CT Pave Set Moissanite Designer Teardrop Bar Necklace is designed for the woman who loves movement, sparkle, and a modern shape with emotional softness. Its designer bar drop silhouette flows into a teardrop-inspired form, creating a graceful vertical line that draws the eye while keeping the look refined and wearable.

Set with 27 round white moissanite stones, this necklace delivers bright D-VS1 sparkle across a pave setting. The 18 inch chain makes it ready to wear or gift, whether chosen for a birthday, anniversary, celebration, romantic surprise, or a personal milestone that deserves a piece with light and meaning.

1 CT Pave Set Moissanite Designer Teardrop Bar Necklace with D-VS1 Round Stones and 18 Inch Chain

This moissanite necklace features 27 round brilliant cut moissanite stones totaling approximately 1.07 carats. The stones are arranged in a pave setting across a designer teardrop bar drop motif, giving the necklace a flowing sparkle that feels polished without being overly heavy. Available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, the design can be selected in the metal tone that best suits the wearer’s style.

What Makes This Special

  • Designer teardrop bar necklace with a graceful drop-inspired silhouette.
  • Features 27 round white moissanite stones.
  • Total moissanite weight is approximately 1.07 carats.
  • Moissanites are D-VS1 quality grade with brilliant cut detailing.
  • Round moissanite dimensions include approximately 1.70 mm, 1.80 mm, 2.10 mm, 2.40 mm, 2.50 mm, and 2.60 mm stones.
  • Pave setting creates a closely set surface of sparkle across the necklace design.
  • Approximate necklace weight is 2.08 gm.
  • Comes with an 18 inch chain for ready-to-wear styling.
  • Available in sterling silver and 10K, 14K, and 18K gold options.
  • Certified jewelry, made with precious metal only, and checked by hand.

Why Choose This Design

The teardrop bar design gives this necklace a distinctive shape that feels both graceful and modern. Its vertical drop helps elongate the neckline, while the rounded teardrop influence adds softness and emotion to the structured bar style.

The pave-set moissanites create a continuous shimmer rather than a single focal sparkle. This makes the necklace easy to wear with both simple and dressed-up looks, because it adds visible light without overpowering the neckline. The D-VS1 white moissanite stones also make it a strong choice for someone who wants brilliant sparkle in a refined everyday-to-occasion necklace.

Design Meaning

A teardrop-inspired design can symbolize emotion, tenderness, joy, and meaningful moments that leave a lasting impression. In this necklace, the flowing drop shape is balanced by a clean designer bar form, creating a piece that feels expressive without being overly sentimental.

The pave moissanite detail adds the feeling of many small moments of light gathered into one design. It can represent memories, milestones, personal growth, or love shared over time, making the necklace a thoughtful gift for someone special or a meaningful self-gift chosen to mark a new chapter.

Authenticity & Craftsmanship

This necklace is comes with a authenticity certificate and checked by hand. The product specifications are: 27 round white moissanite stones with an approximate total weight of 1.07 carats, brilliant cut, pave setting, and D-VS1 quality grade. Visible product details also include the SKU, approximate necklace weight, stone count, stone dimensions, color, cut, shape, setting type, and available metal choices.

The necklace is made to order and crafted in precious metal options, allowing the buyer to choose the finish that best complements the wearer’s style. The pave setting is designed to hold the round moissanites closely across the teardrop bar motif, creating a polished surface of sparkle with a clean, finished look.

Style and Wearability

From the front, the necklace creates a sleek drop line with a sparkling teardrop-bar silhouette. The 18 inch chain places the pendant in a versatile neckline position, making it easy to style with dresses, blouses, eveningwear, or simple everyday outfits.

White metal options create a crisp, bright look with the white moissanite stones, while yellow gold options add warmth and contrast. Wear it alone as a refined statement or layer it with fine chains for a more personal necklace stack. It is especially suited for gifting, celebrations, date nights, office wear, and moments when a little extra sparkle feels right.

Product Information
SKU SHP-PENDANT082210120
Weight 2.08 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 27 Pieces
Total Weight 1.07 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-2 Pcs
Round-1.80X1.80 mm-17 Pcs
Round-2.10X2.10 mm-3 Pcs
Round-2.40X2.40 mm-1 Pcs
Round-2.50X2.50 mm-3 Pcs
Round-2.60X2.60 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: 1 CT Pave Set Moissanite Designer Teardrop Bar Necklace

What makes this moissanite necklace a meaningful gift?

This necklace combines a designer teardrop bar shape with pave-set moissanite sparkle, giving it both emotional softness and a polished modern look. It is a thoughtful choice for birthdays, anniversaries, celebrations, romantic gifts, or personal milestones.

How many moissanite stones are used in this necklace?

The necklace features 27 round moissanite stones. The approximate total moissanite weight is 1.07 carats, with stone sizes ranging from approximately 1.70 mm to 2.60 mm.

What moissanite quality is for this necklace?

The moissanite stones are white in color, brilliant cut, round in shape, and D-VS1 quality grade. They are arranged in a pave setting across the designer teardrop bar motif.

What does the teardrop bar design symbolize?

The teardrop-inspired shape can symbolize emotion, tenderness, joy, and meaningful memories. Paired with the designer bar form, the necklace feels modern while still carrying a soft, sentimental message.

What metal options are available for this moissanite necklace?

This necklace is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These options allow buyers to choose a bright white metal finish or a warmer yellow gold tone.

Does this necklace come with a chain?

Yes. The product page shows this necklace with an 18 inch chain, making it ready to wear or gift when received.

How should I care for this moissanite teardrop bar necklace?

Clean the necklace gently with mild soap, warm water, and a soft brush, then dry it with a lint-free cloth. Avoid harsh chemicals and store it separately in a jewelry box to help protect the pave setting, moissanite stones, chain, and metal finish.