Nature Inspired Diamond Floral Helix Earring

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Sculptural Piece for Curated Ear Styling

This nature inspired diamond floral helix earring is designed for those who prefer expressive yet refined jewelry. Its structure follows the natural curve of the ear, offering a distinctive alternative to traditional stud or hoop styles.

It is particularly suited for curated ear looks where each piece contributes to an intentional composition.

Floral Motif with Organic Flow

The floral design introduces soft, organic lines that contrast with the precision of the diamonds. This combination allows the piece to feel detailed without appearing overly ornate.

The arrangement reflects a nature-inspired aesthetic, giving the earring a sense of movement rather than a static appearance.

Helix Placement for a Distinct Look

Designed for the helix area of the ear, this earring creates a layered visual effect when paired with other pieces. Its placement adds dimension and draws attention upward, enhancing the overall ear styling.

The form is intended to sit securely while maintaining a lightweight and balanced feel.

Diamond Accents for Subtle Brilliance

The diamonds are arranged to complement the floral form, offering controlled sparkle that highlights the design rather than overpowering it. Their placement enhances the contours of the piece and contributes to a refined finish.

This approach ensures the earring remains versatile across both minimal and statement looks.

Designed for Versatility and Expression

This earring can be worn as a standalone accent or combined with other earrings for a layered effect. Its nature-inspired structure makes it adaptable to different styling preferences without feeling repetitive.

It offers a balance between individuality and everyday wearability, making it suitable for a range of occasions.

Product Information
SKU SHP-BODYJ012410020
Weight 0.90 gm (Approximate)
Total Stone Weight 0.05 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

Faq About: Nature Inspired Diamond Floral Helix Earring

What is a helix earring and how is it worn?
A helix earring is designed for the upper cartilage of the ear. It follows the natural curve of the ear to create a layered and elevated look.
Is this earring sold as a single piece or a pair?
Helix earrings are often designed as single pieces for styling flexibility. Please refer to the product details section to confirm the exact offering.
Can this be worn with other earrings?
Yes, it is designed to complement other earrings and works well in curated ear combinations with studs, hoops, or cuffs.
Is the floral design suitable for everyday wear?
The design balances detail and wearability, making it suitable for regular use while still offering a distinctive appearance.
Do helix earrings require a specific type of piercing?
Yes, they are intended for helix piercings located on the upper ear cartilage, not standard lobe piercings.
How secure is the fit for daily wear?
The design is created to sit securely along the ear’s contour, offering stability when worn correctly.