Nature Inspired Citrine Leaf Earrings in Gold Plated Silver

0
Sale price $139 Regular price $198
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a natural twist to your jewelry collection with these uniquely designed Leaf Stud Earrings. Thoughtfully crafted in 14k yellow gold plated silver, these Citrine Earrings offer a fresh and stylish way to elevate your everyday or special occasion look. At the center of each earring is a delicate marquise cut citrine, securely held in prong setting. These Leaf Earrings perfectly blend nature-inspired charm with a modern, wearable design. While the metal leaf motif adds a soft, elegant touch to the structure, creating a look that feels calming and effortlessly stylish. Whether you are dressing up a casual outfit or adding a hint of sophistication to your eveningwear, these Yellow Stone Earrings are a versatile go-to. They are finished with secure screw backs, ensuring comfortable wear that stays in place all day. This pair is ideal for someone who loves unique yet subtle details. The minimalist design is easy to match with other jewelry, while the natural shape brings just the right amount of creativity to your look. Great as a gift for birthdays, anniversaries, or just to treat yourself, these earrings are all about quiet elegance and timeless design.

Product Information
SKU RCEA112122785-FBA
Length 7 mm
Width 4.5 mm
Height 1.5 mm
Weight 0.90 gm (Approximate)
Center Stone Weight 0.22 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-2 Pcs
Color Yellow
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More