Natural Marquise Tanzanite Leaf Earrings with Screw Back

0
Regular price $150
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Let your love for nature and elegant design shine through with these beautifully crafted Leaf Stud Earrings, bringing a soft charm to your everyday style. Made with care in 14K white gold plated silver, these Nature Inspired Earrings showcase a delicate balance between simplicity and thoughtful detail. At the center of each earring is a 2X4 MM marquise shaped tanzanite, carefully set in a secure prong setting. The marquise shape is thoughtfully chosen to resemble the form of a leaf, adding a subtle, nature-inspired touch to the overall design. Whether you are drawn to natural elements or simply appreciate artistic jewelry, these Tanzanite Studs offer a graceful nod to the outdoors while remaining polished and refined. The gold plated framework outlines the leaf motif with clean, modern lines, giving the Tanzanite Earrings a minimal and timeless aesthetic. The combination of fine craftsmanship and graceful design makes these Gold Leaf Earrings a lovely fit for casual days, office looks, or even special moments when you want something understated but unique. Finished with screw back closures, they are built for comfort and security, so you can wear them all day without a second thought.

Product Information
SKU RCEA112122775-FBA
Length 7 mm
Width 4.5 mm
Height 1.5 mm
Weight 0.90 gm (Approximate)
Center Stone Weight 0.23 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More