Natural London Blue Topaz Flower Engagement Ring with Diamond

0
Regular price $1,519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Floral Elegance with Deep Blue Brilliance

This natural London blue topaz flower engagement ring captures the beauty of a blooming motif in a refined, wearable form. The rich blue center stone introduces depth and sophistication, while the floral silhouette adds softness and romantic character.

Accented with diamonds, the design blends vibrant color with delicate sparkle for a balanced and expressive look.

Flower Inspired Design

The flower setting creates a graceful arrangement around the center stone, enhancing its presence without overwhelming the band. The petal-like composition offers dimension and visual interest from multiple angles.

Diamond accents provide contrast and brightness, highlighting the floral outline while maintaining a composed, elegant profile.

Natural London Blue Topaz

London blue topaz is admired for its deep, saturated blue tone with subtle cool undertones. Its clarity and color intensity make it a distinctive choice for those seeking a non-traditional engagement ring.

With proper care and regular maintenance, topaz can be enjoyed as part of everyday wear while preserving its polished finish.

A Distinctive Engagement Choice

This ring is well suited for someone drawn to nature-inspired design paired with bold gemstone color. The combination of floral detailing and diamond accents creates a piece that feels meaningful, feminine, and confidently unique.

Product Information
SKU SHP-RINGS122044435
Width 4.5 mm
Height 10.5 mm
Metal Weight 2.60 gm (Approximate)
Total Stone Weight 1.58 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 6 Pieces
Total Weight 0.96 Carat (Approximate)
Dimension(approx) Oval-3X5 mm-6 Pcs
Color Blue
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 21 Pieces
Total Weight 0.62 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-14 Pcs
Round-1.70X1.70 mm-6 Pcs
Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-rings

FAQs About: London Blue Topaz Flower Ring

What makes a flower engagement ring unique?
A flower engagement ring features a petal-inspired arrangement that frames the center stone, adding dimension and a nature-inspired aesthetic.
Is London blue topaz suitable for daily wear?
London blue topaz can be worn regularly with mindful care. Avoiding strong impact and harsh chemicals helps maintain its surface and brilliance.
How do the diamond accents enhance this design?
The diamond accents add brightness and contrast, emphasizing the floral shape while complementing the deep blue center stone.
Is this ring appropriate as a non-traditional engagement ring?
Yes, its distinctive color and floral design make it a thoughtful choice for someone seeking an engagement ring that stands apart from classic solitaire styles.
Who would appreciate this style most?
This ring appeals to individuals who value nature-inspired motifs, rich gemstone color, and refined detailing in their engagement jewelry.