Natural 0.6 Carat Ruby Flower Engagement Ring with Diamond

0
Sale price $636 Regular price $699
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom with love and elegance through this Flower Engagement Ring, a design inspired by the most beautiful symbol of nature. At its center lies a radiant 5 mm Round Shape Ruby set in Claw Setting within a Flower motif that captures the essence of blossoming romance. The gently Curved Band, adorned with shimmering Diamond stones, adds a graceful touch, enhancing the overall sparkle while perfectly framing the floral centerpiece. As it rests on the finger, the Ruby Engagement Ring creates a soft yet eye-catching look, blending charm and brilliance in a way that stands out effortlessly. This Nature Inspired Engagement Ring is a symbol of growth, new beginnings, and a love that continues to flourish over time, making this piece deeply meaningful. The AAA Quality Ruby represents passion and devotion, while the surrounding Diamond stones of HI-SI Quality add a sense of purity and lasting strength. Perfect as an engagement ring or a thoughtful gift to celebrate a special moment, this Ruby Diamond Engagement Ring carries a romantic spirit that never fades. Presented in a signature jewelry box and available in a range of ring sizes, this ring is ready to become part of your most cherished memories.

Product Information
SKU SHP-RINGS0821183100
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
ruby-engagement-rings