Moissanite Floral Drop Earring for Cartilage Piercing

0
Sale price $452 Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Moissanite Floral Drop Cartilage Earring

This floral drop cartilage earring is designed for those who prefer expressive detail in a refined, minimal form. Created specifically for cartilage piercings, it offers a decorative look without overwhelming the ear.

The single-piece design focuses on balance and proportion, making it suitable for regular wear while maintaining a distinctive appearance.

Floral Drop Design & Setting

The floral motif introduces softness and visual interest, while the drop element adds gentle movement. This design enhances the look of cartilage piercings by drawing attention without excessive length or weight.

The setting is structured to keep the earring stable and secure in place, supporting both comfort and appearance.

Moissanite Stone Characteristics

Moissanite is selected for its durability and suitability for daily wear in fine jewelry. Stones of this type are created without traditional mining, though impact varies by production and energy source.

The stone placement complements the floral design, adding light reflection while maintaining a delicate profile.

High-Level Features

  • Designed specifically for cartilage piercings
  • Floral drop silhouette with balanced proportions
  • Suitable for regular, comfortable wear
  • Refined detailing without excessive bulk
Product Information
SKU SHP-BODYJ012210348
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.48 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 8 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-2X2 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings
Is this earring intended only for cartilage piercings?
Yes, it is designed specifically with cartilage piercings in mind for proper fit and balance.
Can this earring be worn daily?
The design and stone choice make it suitable for regular wear with appropriate care.
Does the drop design feel heavy on the ear?
The proportions are designed to remain lightweight and balanced for comfort.
What style does this earring complement?
It pairs well with delicate, minimal jewelry styles and curated ear looks.
How should this earring be cared for?
Clean gently with a soft cloth and mild solution; avoid harsh chemicals or excessive moisture.