Modern Flower Pendant with Round Citrine and Diamond

0
Sale price $1,325 Regular price $1,489
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Immerse yourself in the captivating allure of this mesmerizing flower pendant. Expertly crafted to captivate attention, this pendant showcases a stunning floral motif embellished with round Diamond and Citrine gemstones. The perfect fusion of these gems creates a timeless charm that is sure to make a statement.

Product Information
SKU SHP-PENDANT032214531
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
citrine-necklaces