Lab Grown Diamond Flower Statement Necklace

0
Regular price $2,199
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Statement Necklace Inspired by Floral Elegance

This lab grown diamond flower statement necklace is designed for those who prefer expressive jewelry that feels refined rather than excessive. The floral composition introduces a sense of movement and symmetry, making it an eye-catching yet balanced piece.

It is well suited for occasions where a single piece defines the overall look, offering a distinctive presence without overwhelming the wearer.

Design That Balances Structure and Artistry

The flower-inspired arrangement is crafted to create visual depth through layered elements and precise placement. Each section contributes to the overall form, ensuring the necklace appears cohesive from every angle.

This structure not only enhances its aesthetic appeal but also supports the stability of the design, allowing it to sit comfortably when worn.

A Composition Designed to Stand Out

Statement necklaces rely on proportion and arrangement rather than size alone. This design achieves that by combining multiple elements into a unified floral motif, creating a focal point that draws attention naturally.

The result is a piece that complements formal attire while remaining versatile enough for select occasions beyond traditional events.

Lab-Grown Diamonds with a Modern Approach

The diamonds in this necklace are created without traditional mining, offering an alternative perspective on sourcing. They provide a familiar brilliance while aligning with contemporary preferences.

Environmental impact varies by production and energy source, making this an option that can be considered within a broader context.

Designed for Occasions That Matter

This necklace is intended for moments where jewelry plays a defining role. Its thoughtful design ensures it remains visually engaging while maintaining a refined and composed appearance.

For those seeking a piece that combines artistic inspiration with modern craftsmanship, this statement necklace offers a distinctive and lasting choice.

Product Information
SKU SHP-PENDANT022510042
Weight 5.00 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 25 Pieces
Total Weight 2.23 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-2 Pcs
Round-1.10X1.10 mm-9 Pcs
Round-1.20X1.20 mm-1 Pcs
Round-1.30X1.30 mm-10 Pcs
Round-1.40X1.40 mm-2 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Faq About: Lab Grown Diamond Flower Statement Necklace

What makes a statement necklace different from regular necklaces?
Statement necklaces are designed to be the focal point of an outfit, featuring more elaborate designs and a stronger visual presence than everyday necklaces.
Is this necklace suitable for everyday wear?
This necklace is primarily suited for special occasions due to its statement design, though it can be worn selectively depending on personal style.
Are lab-grown diamonds visually different from natural diamonds?
Lab-grown diamonds have the same appearance and brilliance as natural diamonds.
Will the necklace sit comfortably on the neckline?
The design is structured to rest securely and comfortably, allowing the necklace to maintain its shape when worn.
How should a detailed necklace be cared for?
Regular cleaning and careful storage help maintain the appearance of intricate designs and prevent unnecessary wear.
Can this necklace be layered with other pieces?
Due to its statement nature, it is typically worn on its own, though it can be paired with subtle pieces if desired.