Lab Grown Diamond Crown Statement Necklace

0
Sale price $356 Regular price $409
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Sparkle meets eternity in this dazzling Infinity Sign Necklace, where every diamond whispers luxury and every curve tells a story of timeless beauty. This Minimalist Necklace has an infinity symbol encrusted with round cut lab made diamonds, representing eternal love and endless possibilities. Adding a regal touch, a delicate diamond-studded crown motif is set at the top of infinity. Not only does this Diamond Necklace exude luxury, but it also reflects a conscious choice, handcrafted with lab grown gemstones, it is eco-friendly and affordable. It is a perfect mix of timeless beauty and royal charm, giving you all the equal sparkle of a mined diamond.

Product Information
SKU SHP-PENDANT022510053
Metal Weight 3.20 gm (Approximate)
Total Stone Weight 0.40 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 58 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-13 Pcs
Round-1.10X1.10 mm-9 Pcs
Round-1.20X1.20 mm-35 Pcs
Round-1.30X1.30 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade EF-VS
View More